BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1076 (781 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_49315| Best HMM Match : Calreticulin (HMM E-Value=0) 41 0.001 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 34 0.11 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_15380| Best HMM Match : RA (HMM E-Value=0.11) 32 0.60 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 31 0.79 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 0.79 SB_33554| Best HMM Match : Sushi (HMM E-Value=0.00055) 31 1.0 SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_52009| Best HMM Match : Plasmodium_HRP (HMM E-Value=7.9) 31 1.0 SB_22454| Best HMM Match : Ribosomal_L35p (HMM E-Value=4.5) 31 1.4 SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_6510| Best HMM Match : Vicilin_N (HMM E-Value=0.44) 30 1.8 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 30 1.8 SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) 30 1.8 SB_24053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) 30 2.4 SB_16503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 29 3.2 SB_6974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_40992| Best HMM Match : DUF1531 (HMM E-Value=5.7) 29 3.2 SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) 29 5.6 SB_47093| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_28078| Best HMM Match : SGS (HMM E-Value=1.5) 29 5.6 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 29 5.6 SB_16163| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_5458| Best HMM Match : E-MAP-115 (HMM E-Value=0.3) 29 5.6 SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 29 5.6 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 29 5.6 SB_4028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_51787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_28255| Best HMM Match : Curto_V2 (HMM E-Value=0.79) 28 7.4 SB_13014| Best HMM Match : DUF837 (HMM E-Value=2.2) 28 7.4 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 28 7.4 SB_58809| Best HMM Match : CXC (HMM E-Value=5.7) 28 7.4 SB_56949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_37125| Best HMM Match : DUF1542 (HMM E-Value=0.76) 28 7.4 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_12654| Best HMM Match : CXC (HMM E-Value=5.7) 28 7.4 SB_10985| Best HMM Match : E-MAP-115 (HMM E-Value=5.5) 28 7.4 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_5834| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 28 9.8 SB_50251| Best HMM Match : Transgly_assoc (HMM E-Value=4) 28 9.8 SB_47268| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_37137| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 28 9.8 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_11304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_49493| Best HMM Match : CXC (HMM E-Value=9.4) 28 9.8 SB_35592| Best HMM Match : zf-CCHC (HMM E-Value=0.0087) 28 9.8 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 28 9.8 >SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 106 bits (254), Expect = 2e-23 Identities = 50/84 (59%), Positives = 59/84 (70%), Gaps = 1/84 (1%) Frame = +3 Query: 6 WVHPEIDNPEYTPDSNLYKRDEICAVGLDLWQVKSGTIFDDFLITDDPAAAKE-RGEVIK 182 WVHPEIDNPEY D LY +I A+G DLWQVKSGTIFD+ L+TD A++ E Sbjct: 972 WVHPEIDNPEYKADDKLYMYKDIGAIGFDLWQVKSGTIFDNVLVTDSVEHAEQFAKETFD 1031 Query: 183 KRQEGEKKMKSEQDEAEREKEKAE 254 K +EGEKKMK EQDE ER+K + E Sbjct: 1032 KTKEGEKKMKDEQDEIERKKAEEE 1055 >SB_49315| Best HMM Match : Calreticulin (HMM E-Value=0) Length = 1086 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 5/86 (5%) Frame = +3 Query: 6 WVHPEIDNPEYTPDSNLYKRDEI---CAVGLDLWQVKSGTIFDDFLITDDPAAAKE--RG 170 W P DNPEY + D VGL+LW + S +FD+ ++T+D A A + + Sbjct: 224 WKPPMADNPEYKGKWSAPLIDNPNYKVGVGLELWSMTSDILFDNVIVTNDKAVADKWAQD 283 Query: 171 EVIKKRQEGEKKMKSEQDEAEREKEK 248 +KK + SE + E + E+ Sbjct: 284 SWLKKNVKETYGASSEGETKEEDNEE 309 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +3 Query: 141 DDPAAAKERGEVIKKRQEGEK-KMKSEQDEAEREKEKAES 257 D + K++GE K + E EK K +SE+D+ E EKEK +S Sbjct: 1519 DKGESEKDKGESEKDKGESEKDKGESEKDKGESEKEKCQS 1558 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +3 Query: 159 KERGEVIKKRQEGEK-KMKSEQDEAEREKEKAES 257 K++GE K + E EK K +SE+D+ E EK+K ES Sbjct: 1518 KDKGESEKDKGESEKDKGESEKDKGESEKDKGES 1551 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = +3 Query: 159 KERGEVIKKRQEGEK-KMKSEQDEAEREKEKAES 257 K +GE K + E EK K +SE+D+ E EK+K ES Sbjct: 1511 KGKGESEKDKGESEKDKGESEKDKGESEKDKGES 1544 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 165 RGEVIKKRQEGEK-KMKSEQDEAEREKEKAES 257 + E K + E EK K +SE+D+ E EK+K ES Sbjct: 1506 KSESEKGKGESEKDKGESEKDKGESEKDKGES 1537 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +3 Query: 141 DDPAAAKERGEVIKKRQEGEK-KMKSEQDEAEREKEKAES 257 D + K++GE K + E EK K +SE+D+ E EKEK +S Sbjct: 98 DKGESEKDKGESEKDKGESEKDKGESEKDKGESEKEKCQS 137 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +3 Query: 159 KERGEVIKKRQEGEK-KMKSEQDEAEREKEKAES 257 K++GE K + E EK K +SE+D+ E EK+K ES Sbjct: 97 KDKGESEKDKGESEKDKGESEKDKGESEKDKGES 130 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = +3 Query: 159 KERGEVIKKRQEGEK-KMKSEQDEAEREKEKAES 257 K +GE K + E EK K +SE+D+ E EK+K ES Sbjct: 90 KGKGESEKDKGESEKDKGESEKDKGESEKDKGES 123 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 165 RGEVIKKRQEGEK-KMKSEQDEAEREKEKAES 257 + E K + E EK K +SE+D+ E EK+K ES Sbjct: 85 KSESEKGKGESEKDKGESEKDKGESEKDKGES 116 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 33.1 bits (72), Expect = 0.26 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 K+R E KKR+E E+K + E++ ++EKE+ Sbjct: 467 KQREEEEKKREEEERKQREEEERKQKEKEE 496 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 K E K+R+E E+K K +++E +R++E+ Sbjct: 475 KREEEERKQREEEERKQKEKEEEKKRKEEE 504 >SB_15380| Best HMM Match : RA (HMM E-Value=0.11) Length = 2124 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/67 (26%), Positives = 36/67 (53%) Frame = +3 Query: 54 LYKRDEICAVGLDLWQVKSGTIFDDFLITDDPAAAKERGEVIKKRQEGEKKMKSEQDEAE 233 +Y+ +E+ + W+ K G + + ++ ++ GEV + +EG K+ + E DE+E Sbjct: 1129 MYQVNEVDKSDKEGWKEKEGEVDE----SEKEGWKEKEGEVDESEKEGWKEKEGEVDESE 1184 Query: 234 REKEKAE 254 +E K E Sbjct: 1185 KEGWKTE 1191 >SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) Length = 872 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 141 DDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 ++ AAA V+KK +E E++ + E++E E E+E+ E Sbjct: 510 EEVAAAAAAVVVVKKEEEEEEEEEEEEEEEEEEEEEEE 547 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/46 (36%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = +3 Query: 117 IFDDFLITDDPAAAKERGEVIKKRQEG-EKKMKSEQDEAEREKEKA 251 IF+ FL++ A AK + E IKK++E E+K ++ ++ ER+++K+ Sbjct: 586 IFNVFLVSF--AEAKHQNEEIKKKKEAEERKRRALAEQKERDRQKS 629 >SB_33554| Best HMM Match : Sushi (HMM E-Value=0.00055) Length = 685 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -1 Query: 661 KLYIHVPAHG-ARPITKH*IITYINSERNPHLHGHQYETTDTYLLT 527 ++++H P H AR T+ TY + H+H H+Y T+ T Sbjct: 263 QMHVHAPGHANARTRTQARKCTYTHPGTQMHVHAHKYANAHTHTQT 308 >SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +3 Query: 156 AKERGEVIKKRQEGEKKMKSEQDEAEREKEKAESL 260 AK++ E +KR E +KK + EA ++KEKA+S+ Sbjct: 325 AKKQEEEERKRDEEKKKAERAAAEARKKKEKAKSV 359 >SB_52009| Best HMM Match : Plasmodium_HRP (HMM E-Value=7.9) Length = 231 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -1 Query: 661 KLYIHVPAHG-ARPITKH*IITYINSERNPHLHGHQYETTDTYLLT 527 ++++H P H AR T+ TY + H+H H+Y T+ T Sbjct: 38 QMHVHAPGHANARTRTQARKCTYTHPGTQMHVHAHKYANAHTHTQT 83 >SB_22454| Best HMM Match : Ribosomal_L35p (HMM E-Value=4.5) Length = 214 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIF--TYTQHVPTIGKIR 495 Y+ TLH P+T + N+ LNN I P ++ + N GH F +H P K+R Sbjct: 43 YNYTLHYEPNTTSKRKNRQLNNIIWYN---PPFSKNTSTNIGHRFLSLIDKHFPKDHKLR 99 >SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 K++ + KK+Q+ +KK K E++E E E E+ E Sbjct: 12 KKKKKRKKKKQKKQKKKKEEEEEEEEENEEEE 43 >SB_6510| Best HMM Match : Vicilin_N (HMM E-Value=0.44) Length = 270 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/30 (50%), Positives = 23/30 (76%) Frame = +3 Query: 156 AKERGEVIKKRQEGEKKMKSEQDEAEREKE 245 A+ R E KK++E E+++K+EQ EAE+E E Sbjct: 134 ARRRAEREKKKKEEEERLKAEQ-EAEQEAE 162 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/33 (33%), Positives = 25/33 (75%) Frame = +3 Query: 150 AAAKERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 A AKER ++R++GE++ + E+++ ++E+E+ Sbjct: 389 AEAKERERQEEERRKGEERQRQEEEKRQKEEEE 421 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 + R + K+R E E K K+E+++A REK + E Sbjct: 246 ERRRQEEKRRAEEEAKRKAEEEKAAREKAEME 277 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 180 KKRQEGEKKMKSEQDEAEREKEKAESL 260 K+ +E E++ + E+D RE+E+AE L Sbjct: 506 KETEERERQAREEEDRIRREREEAERL 532 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 KE E+ KKRQE ++ + ++ E K KAE Sbjct: 234 KELAELEKKRQEERRRQEEKRRAEEEAKRKAE 265 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 4/36 (11%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQD----EAEREKEKAE 254 + +GE ++RQE EK+ K E++ EAER++E+ E Sbjct: 401 RRKGEE-RQRQEEEKRQKEEEERLRVEAERQREEDE 435 >SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) Length = 592 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +3 Query: 150 AAAKERGEVIKKRQEGEKKMKSEQDEAER-EKEKAES 257 AA K R EV +KR+E E+ + + +EAER E+ + E+ Sbjct: 336 AAEKRRQEVERKRREREEAKRKQLEEAERLERVRLEA 372 >SB_24053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2557 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/30 (50%), Positives = 23/30 (76%) Frame = +3 Query: 156 AKERGEVIKKRQEGEKKMKSEQDEAEREKE 245 A+ R E KK++E E+++K+EQ EAE+E E Sbjct: 2316 ARRRAEREKKKKEEEERLKAEQ-EAEQEAE 2344 >SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) Length = 2322 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 162 ERGEVIKKRQEGEKKMKSEQDEAEREKEKAES 257 E E +KR E E KM+ E ++ +E+E+AE+ Sbjct: 215 EEEEEARKRAELEDKMRRENEKKRKEEERAEA 246 >SB_16503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +3 Query: 120 FDDFLITDDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAESL 260 F+ F ++ A E + K+++E E+K+K EQ EA+ ++++ E L Sbjct: 512 FNYFYHRENEQRAAEASKKEKEKKEAERKLKEEQ-EAQLDEQEVEKL 557 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +3 Query: 138 TDDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 T++ A + E +K++E E+K K E++ ERE+++ Sbjct: 914 TEEKARIMKEIEEKEKKEEAERKAKEEKEREERERKR 950 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 KE+ E K+R++ ++K K + E ERE+EK Sbjct: 633 KEKEERDKEREKEKEKEKEREKEKEREREK 662 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 141 DDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 +D KER + +K + +++ K ++ E EREKEK Sbjct: 621 NDREREKEREKEKEKEERDKEREKEKEKEKEREKEK 656 >SB_6974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 29.5 bits (63), Expect = 3.2 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIF--TYTQHVPTIGKIR 495 Y+ TLH P+T + N+ NN I P ++ + N GH F QH P K+R Sbjct: 51 YNYTLHYEPNTTNKLKNRQCNNIIWYN---PPFSKNTSTNIGHRFFSLIDQHFPKDHKLR 107 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/34 (35%), Positives = 24/34 (70%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEKAESL 260 +++ E K+R+E EK+ K E+++ EREK +++ Sbjct: 209 RQQEEEKKRREEEEKRKKVEKEKQEREKAAKKNI 242 >SB_40992| Best HMM Match : DUF1531 (HMM E-Value=5.7) Length = 104 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 141 DDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 DDP+ K+ + KK+Q + +++E E EKEK E Sbjct: 37 DDPSGEKDEEKGEKKKQLKADEEDGKKEEEEGEKEKTE 74 >SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/29 (37%), Positives = 22/29 (75%) Frame = +3 Query: 171 EVIKKRQEGEKKMKSEQDEAEREKEKAES 257 +V +KR+EG+ + + ++ E ++KEKAE+ Sbjct: 25 KVREKREEGDTRREEKRGEERKKKEKAET 53 >SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) Length = 599 Score = 28.7 bits (61), Expect = 5.6 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 6/56 (10%) Frame = +3 Query: 105 KSGTIFDD----FLITDDPAAAKERG--EVIKKRQEGEKKMKSEQDEAEREKEKAE 254 +SG+ DD F D E+G E+ K+RQ+ + K+K E++E E KE+AE Sbjct: 77 RSGSTTDDKRTIFTFEDKRKQNFEKGRLELEKRRQDLQDKLKREKEERE-AKERAE 131 >SB_47093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 28.7 bits (61), Expect = 5.6 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIF--TYTQHVPTIGKIR 495 Y+ TLH P+T + N+ NN I P ++ + N GH F +H P K+R Sbjct: 200 YNYTLHYEPNTTSKHKNRQRNNIIWYN---PPFSKNTSTNIGHRFLSLIDKHFPKDHKLR 256 Query: 494 AKHT 483 T Sbjct: 257 KTST 260 >SB_28078| Best HMM Match : SGS (HMM E-Value=1.5) Length = 934 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = -3 Query: 455 YWNCRRLRNERF*KKNSPRTHTTYPEVLNVLALTN*SQQPTAHRVPP 315 YWN R R+ R + +SPR T + +T+ S P PP Sbjct: 107 YWNSGR-RSPRHSRPSSPRCRTPRNNIFTTPMITSTSASPRGSMAPP 152 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/30 (36%), Positives = 22/30 (73%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 K++ +K+R++ +K+MK ++DE E+EK Sbjct: 139 KKQESDLKRREQWQKEMKQKKDEQVDEREK 168 >SB_16163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +3 Query: 183 KRQEGEKKMKSEQDEAEREKEK 248 KRQE E+K K ++ AE+EKE+ Sbjct: 706 KRQEKEEKEKRAKERAEKEKER 727 >SB_5458| Best HMM Match : E-MAP-115 (HMM E-Value=0.3) Length = 274 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/30 (36%), Positives = 22/30 (73%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 K++ +K+R++ +K+MK ++DE E+EK Sbjct: 143 KKQESDLKRREQWQKEMKQKKDEQVDEREK 172 >SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 813 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 165 RGEVIKKRQEGEKKMKSEQDEAEREKEKAESL 260 R V+ + +EGE K +S+ ++ +E+E+ ESL Sbjct: 420 RNVVLSEEKEGEVKEESKAEQKVKEEERLESL 451 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = +3 Query: 123 DDFLITDDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 D+F + PA+ E E ++ + E++ + E++E E E+E+ E Sbjct: 182 DEFYLFAVPASVVEEEEEEEEEEVEEEEEEEEEEEEEEEEEEEE 225 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 KE+ E +KK ++ ++K + E+ E E+EKEK + Sbjct: 140 KEK-ERMKKEEKHKEKTRKEEKEREKEKEKTK 170 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 616 LLSVWHRVLGRECKVLLYNNIRCSSPNVLYDC-DCYCTVNLFLILSCEMSNK 768 L SV + + +LY+ I C +VLYD DC + L+ + C +S K Sbjct: 221 LSSVLYDAIDCRLSSVLYDAIDCRLSDVLYDAIDCRLSGVLYDAIDCRLSAK 272 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 616 LLSVWHRVLGRECKVLLYNNIRCSSPNVLYDC-DCYCTVNLFLILSCEMS 762 L SV + + +LY+ I C +VLYD DC + L+ + C +S Sbjct: 89 LSSVLYDAIDCRLSCVLYDAIDCRLSSVLYDAIDCRLSDVLYDAIDCRLS 138 >SB_4028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +3 Query: 162 ERGEVIKKRQEGEKKMKSEQDEAE--REKEKAE 254 E+ + +KK+++ +KK K E+DE E + KEK E Sbjct: 194 EKVKRLKKKKKKKKKKKEEEDEKEDKQRKEKTE 226 >SB_51787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIF--TYTQHVPTIGKIR 495 Y+ TLH P+T + N+ NN I P ++ + N GH F +H P K+R Sbjct: 128 YNYTLHYEPNTTSKRKNRQRNNIIWYN---PPFSKNTSTNIGHRFLSLIDKHFPKDHKLR 184 >SB_28255| Best HMM Match : Curto_V2 (HMM E-Value=0.79) Length = 364 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 496 EPNTRTVLKTNDNS-IGIVEDCATRGFKKRILHA 398 EP T+ +T DNS I I EDC+T K I A Sbjct: 119 EPERLTIKETRDNSVISIEEDCSTDAEMKVIYDA 152 >SB_13014| Best HMM Match : DUF837 (HMM E-Value=2.2) Length = 238 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +3 Query: 111 GTIFDDFLITDDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAES 257 G + D DDP ++ R + +KR E + SE D+ ERE + E+ Sbjct: 170 GVVTTDRETIDDPKTSESRRQEARKRNE---ERLSEVDKLERENRELEN 215 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 K + E KKR+E E+K + E++ A++ K++ Sbjct: 257 KRKEEAEKKREEEERKRREEEEAAQKWKKE 286 >SB_58809| Best HMM Match : CXC (HMM E-Value=5.7) Length = 202 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIF--TYTQHVPTIGKIR 495 Y+ TLH P+T + N+ NN I P ++ + N GH F +H P K+R Sbjct: 55 YNYTLHYEPNTTSKRKNRQRNNIIWYN---PPFSKNTSTNIGHRFLSLIDKHFPKDHKLR 111 >SB_56949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIF--TYTQHVPTIGKIR 495 Y+ TLH P+T + N+ NN I P ++ + N GH F +H P K+R Sbjct: 232 YNYTLHYEPNTTSKRKNRQRNNIIWYN---PPFSKNTSTNIGHRFLSLIDKHFPKDHKLR 288 >SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1718 Score = 28.3 bits (60), Expect = 7.4 Identities = 22/100 (22%), Positives = 43/100 (43%), Gaps = 3/100 (3%) Frame = -1 Query: 718 NNHNHTKH*GYYIECYCTVKLYIHVPAHGARPITKH*IITYINSERNPHLHGHQYETTDT 539 N+ + TKH C + LY + + + I + +N + + ++D Sbjct: 109 NHSSETKH-SRESTCDVSPNLYSKPKQDEQKLLNDDNVDILIEAPQNDCVANEKGASSDV 167 Query: 538 YLLTHNMSLR---SVKFEPNTRTVLKTNDNSIGIVEDCAT 428 + +HNM + + E +++T DNS+GI+ D T Sbjct: 168 EV-SHNMGNKLPVEISKESRNNVIVQTGDNSLGIINDNGT 206 >SB_37125| Best HMM Match : DUF1542 (HMM E-Value=0.76) Length = 580 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 153 AAKERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 A +ERG K +G++K K ++ E E+ KEK Sbjct: 270 AREERGGQAGKESKGKEKGKEKEKEKEKGKEK 301 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 1/76 (1%) Frame = +3 Query: 9 VHPEIDNPEYTPDSNLYKRDEICAVGLDLWQVKSGTIFDDFLITDDPAAAKERGEV-IKK 185 V P +DNPE+ PD K + A G+ W + + F + A E + Sbjct: 3447 VQPYLDNPEFEPD--FIKGKSLAAGGICAWVINIVQFYYIFCDVEPKRKALEAANAELAA 3504 Query: 186 RQEGEKKMKSEQDEAE 233 +E K+K++ E + Sbjct: 3505 AEEKLSKIKAKIQELD 3520 >SB_12654| Best HMM Match : CXC (HMM E-Value=5.7) Length = 202 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIF--TYTQHVPTIGKIR 495 Y+ TLH P+T + N+ NN I P ++ + N GH F +H P K+R Sbjct: 55 YNYTLHYEPNTTSKRKNRQRNNIIWYN---PPFSKNTSTNIGHRFLSLIDKHFPKDHKLR 111 >SB_10985| Best HMM Match : E-MAP-115 (HMM E-Value=5.5) Length = 320 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 496 EPNTRTVLKTNDNS-IGIVEDCATRGFKKRILHA 398 EP T+ +T DNS I I EDC+T K I A Sbjct: 33 EPERLTIKETRDNSAISIEEDCSTDAEMKVIYDA 66 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/37 (35%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = +3 Query: 153 AAKERGEVIKKRQEGEKKMKSEQD---EAEREKEKAE 254 A ++R + +++E EK+++S +D E +++KEKAE Sbjct: 1601 AKRDRDKYQLEKEEAEKRLQSYEDELNEKQKQKEKAE 1637 >SB_5834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 495 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIF--TYTQHVPTIGKIR 495 Y+ TLH P+T + N+ NN I P ++ + N GH F +H P K+R Sbjct: 248 YNYTLHYEPNTTSKRKNRQRNNIIWYN---PPFSKNTSTNIGHRFLSLIDKHFPKDHKLR 304 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/34 (35%), Positives = 24/34 (70%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEKAESL 260 ++R E KKR+E EK+++ E+ +E+E+ ++L Sbjct: 1087 EKRKEQEKKRKEEEKRIRDEELRLLKEREEEQAL 1120 >SB_50251| Best HMM Match : Transgly_assoc (HMM E-Value=4) Length = 158 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 99 QVKSGTIFDDFLITDDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAES 257 Q G + D DDP ++ R + ++R E + SE DE ERE + E+ Sbjct: 19 QELQGVVATDRETIDDPNTSESRRQEARERNE---ERLSEIDEQERENRELEN 68 >SB_47268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +3 Query: 132 LITDDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAES 257 +IT D KE+ + I Q GE S D EKEK S Sbjct: 412 IITKDKCQGKEKKKNISLGQGGESATNSSGDLLNGEKEKVAS 453 >SB_37137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIF--TYTQHVPTIGKIR 495 Y+ TLH P+T + N+ NN I P ++ + N GH F +H P K+R Sbjct: 21 YNYTLHYEPNTTSKGKNRQRNNIIWYN---PPFSKNTSTNIGHRFLSLIDKHFPKDHKLR 77 >SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) Length = 1353 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIFTYTQHVPTIGKIR 495 Y+ TLH P+T + N+ NN I S +T T++ ++ + +H P K+R Sbjct: 1213 YNYTLHYEPNTTSKRKNRQRNNIIWYNPPFSKNTSTNI-SHRFLSLIDKHFPKDHKLR 1269 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +3 Query: 180 KKRQEGEKKMKSEQDEAEREKEK 248 K+RQE EK+ + E++ ++EKEK Sbjct: 322 KERQEREKEKEREKERIQQEKEK 344 >SB_11304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 144 DPAAAKERGEVIKKRQEGEKKMKSEQDEAERE 239 +P A +ER EVI+ R +G + +D +RE Sbjct: 275 EPDAKEERREVIRDRGDGRQSRVRNKDRPDRE 306 >SB_49493| Best HMM Match : CXC (HMM E-Value=9.4) Length = 201 Score = 27.9 bits (59), Expect = 9.8 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = -3 Query: 668 YSKTLHSRPSTRCQTDNKTLNNYIHQF*A*SPSTRTSVRNNGHIF--TYTQHVPTIGKIR 495 Y+ TLH P+T + N+ NN I S +T T++ GH F +H P K+R Sbjct: 51 YNYTLHYEPNTTSKRKNRQRNNIIWYNPHFSKNTSTNI---GHRFLSLIDKHFPKDHKLR 107 >SB_35592| Best HMM Match : zf-CCHC (HMM E-Value=0.0087) Length = 556 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/28 (39%), Positives = 21/28 (75%) Frame = +3 Query: 177 IKKRQEGEKKMKSEQDEAEREKEKAESL 260 +K++QE + M+ +D A+REKEK +++ Sbjct: 369 VKEKQELIRCMREVEDAAQREKEKRKAI 396 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/37 (37%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +3 Query: 150 AAAKERGEVI--KKRQEGEKKMKSEQDEAEREKEKAE 254 AAA+ER + I KK++ ++ K E++ ER+++K E Sbjct: 608 AAAEERKKEIENKKKEIDDEMRKLEEERTERDRQKEE 644 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,257,589 Number of Sequences: 59808 Number of extensions: 433729 Number of successful extensions: 1901 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 1527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1868 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -