BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1076 (781 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 117 4e-28 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 29 0.16 AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 26 1.5 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 2.6 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 24 6.1 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 24 6.1 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 6.1 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 6.1 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 6.1 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 6.1 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 6.1 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 6.1 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 6.1 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 6.1 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 6.1 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 6.1 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 6.1 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 6.1 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 23 8.0 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 23 8.0 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 117 bits (282), Expect = 4e-28 Identities = 50/84 (59%), Positives = 66/84 (78%) Frame = +3 Query: 6 WVHPEIDNPEYTPDSNLYKRDEICAVGLDLWQVKSGTIFDDFLITDDPAAAKERGEVIKK 185 WVHPEIDNPEY D +LY R+E+CAVG+D+WQVKSGTIFD+F+IT+D AK+ +K+ Sbjct: 286 WVHPEIDNPEYEEDKSLYLREEVCAVGIDVWQVKSGTIFDNFMITNDLEEAKKVAASVKE 345 Query: 186 RQEGEKKMKSEQDEAEREKEKAES 257 QEGEKK+K Q+ ER+K + E+ Sbjct: 346 TQEGEKKVKDAQEAEERKKAEGEA 369 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 29.1 bits (62), Expect = 0.16 Identities = 12/32 (37%), Positives = 23/32 (71%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 +ER + K+++E E++ K E++ +REKE+ E Sbjct: 478 REREQREKEQREKEQREKEERERQQREKEQRE 509 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 +ER + K+++E E++ K + EA RE+E+ Sbjct: 498 RERQQREKEQREREQREKEREREAARERER 527 Score = 23.8 bits (49), Expect = 6.1 Identities = 8/30 (26%), Positives = 21/30 (70%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 +E+ + K+ +E +++ K +++ +REKE+ Sbjct: 488 REKEQREKEERERQQREKEQREREQREKER 517 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 25.8 bits (54), Expect = 1.5 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 577 PHLHGHQYETTDTYLLTHNMSLRS-VKFEPNTRTVLKTNDNSIGIVEDCAT 428 P LH + D + +M+ + E NT+ +L S+G+ +D AT Sbjct: 50 PDLHTTSKRSADNFAKPSDMATEDWMNVEDNTQQILDQQLQSVGMPDDRAT 100 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.0 bits (52), Expect = 2.6 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -3 Query: 407 SPRTHTTYPEVLNVLALTN*SQQPTAHRVPPQALRLQSHRRGPHHLPH 264 +P H + P + +T+ + P AH P A S GP HL H Sbjct: 182 APIAHYSAPIAHHAAPITHYAA-PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 100 CHKSRPTAQISSRLYRFESGVYSGLSISG 14 C K T +I +L +FES S L++ G Sbjct: 491 CAKQSETTRIEKQLEQFESAPRSKLAVYG 519 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.8 bits (49), Expect = 6.1 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 344 QQPTAHRVPPQALRLQSHRRGPHHLP 267 QQ H+ PQ Q + PHH P Sbjct: 309 QQHHHHQHQPQQQHQQQYHSHPHHTP 334 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 205 PIAHHAAPIAHSTSSIVHGPSHLSH 229 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 204 PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 204 PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 207 PIAHHAAPIAHSTSSIVHGPSHLSH 231 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 212 PIAHHAAPIAHSTSSIVHGPSHLSH 236 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 204 PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 212 PIAHHAAPIAHSTSSIVHGPSHLSH 236 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 236 PIAHHAAPIAHSTSSIVHGPSHLSH 260 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 204 PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 205 PIAHHAAPIAHSTSSIVHGPSHLSH 229 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 204 PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 338 PTAHRVPPQALRLQSHRRGPHHLPH 264 P AH P A S GP HL H Sbjct: 212 PIAHHAAPIAHSTSSIVHGPSHLSH 236 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.4 bits (48), Expect = 8.0 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 658 LYIHVPAHGARPITKH*IITYINSERNPHLHGH 560 L ++VP +G H +I +I+ N +L GH Sbjct: 354 LSVNVPYYGNYHSLGHVLIGFIHDPDNLYLEGH 386 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 201 KKMKSEQDEAEREKEKA 251 KK + ++EA R+KEKA Sbjct: 82 KKSRETKEEARRDKEKA 98 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 729,140 Number of Sequences: 2352 Number of extensions: 15501 Number of successful extensions: 41 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -