BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1076 (781 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 25 0.79 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 25 0.79 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 4.2 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 5.6 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 5.6 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 7.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 7.4 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 7.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 9.7 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 9.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 9.7 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 9.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 9.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 9.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 9.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 9.7 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 9.7 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 9.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 9.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 9.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 9.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 9.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 9.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 9.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 9.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 9.7 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 25.0 bits (52), Expect = 0.79 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 463 HLFLALCVCLARILPIVGTCCV 528 H+ LA+ + I+ +VG CCV Sbjct: 57 HIGLAIIYSMLLIMSLVGNCCV 78 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 25.0 bits (52), Expect = 0.79 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 463 HLFLALCVCLARILPIVGTCCV 528 H+ LA+ + I+ +VG CCV Sbjct: 57 HIGLAIIYSMLLIMSLVGNCCV 78 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 602 NYLMFCYRSGTVCWDVNVKFYCTITFDVVA 691 +Y R+G CWD N + TF +VA Sbjct: 311 DYFTQINRNGIACWDTNTELNPN-TFILVA 339 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 724 YNNNHNHTKH*GYYIECYCTVKLYIHVPAH 635 YNNN+N+ K Y I + + + VP + Sbjct: 96 YNNNNNYNKKLYYNINYIEQIPVPVPVPIY 125 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 724 YNNNHNHTKH*GYYIECYCTVKLYIHVPAH 635 YNNN+N+ K Y I + + + VP + Sbjct: 334 YNNNNNYNKKLYYNINYIEQIPVPVPVPIY 363 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 221 SLRNRTHGFQHTSSRYSR 238 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 7.4 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 724 YNNNHNHTKH 695 YN+NHN +H Sbjct: 425 YNHNHNQARH 434 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRNRTHDFQHTSSRYSR 233 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHDFQHTSSRYSR 233 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 205 SLRSRTHGFQHTSSRYSR 222 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 205 SLRSRTHGFQHTSSRYSR 222 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSRYSR 233 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSRYSR 233 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSHYSR 233 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSHYSR 233 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSHYSR 233 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSHYSR 233 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 205 SLRSRTHGFQHTSSHYSR 222 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSHYSR 233 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSRYSR 233 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 205 SLRNRTHGFQHTSSRYSR 222 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRNRTHGFQHTSSRYSR 233 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRNRTHGFQHTSSRYSR 233 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 205 SLRNRTHGFQHTSSRYSR 222 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSRYSR 233 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRNRTHGFQHTSSRYSR 233 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSRYSR 233 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSRYSR 233 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 205 SLRNRTHGFQHTSSRYSR 222 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRNRTHGFQHTSSRYSR 233 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRSRTHGFQHTSSRYSR 233 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 558 STKQRTHIYLHTTCPYDR 505 S + RTH + HT+ Y R Sbjct: 216 SLRNRTHGFQHTSSRYSR 233 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,985 Number of Sequences: 438 Number of extensions: 3798 Number of successful extensions: 34 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -