BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1074 (734 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB2B4.05 |vma5||V-type ATPase subunit C|Schizosaccharomyces p... 27 2.1 SPCC1223.04c |mug76||lysine methyltransferase |Schizosaccharomyc... 26 6.4 >SPAPB2B4.05 |vma5||V-type ATPase subunit C|Schizosaccharomyces pombe|chr 1|||Manual Length = 394 Score = 27.5 bits (58), Expect = 2.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 87 SLRNYTETLEPVSQGGWRHLRCRCLFYYVLLR 182 SL Y S GW HL+C C++ +LR Sbjct: 283 SLLRYASIAFSESFQGWIHLKCLCVYVESILR 314 >SPCC1223.04c |mug76||lysine methyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 381 Score = 25.8 bits (54), Expect = 6.4 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 48 RRSSNAFPLEGCGSLRNYTETLEPVSQGGWRHLRCRCLFY 167 R++ AF E ++ + +P Q GW + RCL+Y Sbjct: 132 RKNVMAFDYE---QVKKFVSVDQPTFQWGWLCVNTRCLYY 168 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,787,155 Number of Sequences: 5004 Number of extensions: 56260 Number of successful extensions: 127 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -