BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1074 (734 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21463| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_4606| Best HMM Match : HlyIII (HMM E-Value=0.002) 30 1.7 >SB_21463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 84 GSLRNYTETLEPVSQGGWRHLRC-RCLFYYVLLRT*YLCTYMMHSSL 221 GS+++ E L+ ++ W H+ C C+F + +LC +M SL Sbjct: 355 GSIQSNQENLKAFAEKAWNHILCSSCIFPCASIFLRFLCPAIMSPSL 401 >SB_4606| Best HMM Match : HlyIII (HMM E-Value=0.002) Length = 458 Score = 30.3 bits (65), Expect = 1.7 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 4/72 (5%) Frame = +1 Query: 334 GSILFAKSLYTGCILSGWLSYCVFNS--DCLHYVSNIINQRKRFF--VIFIIGYR*NVYY 501 G LF + L GC G L YCV C+ V NI +++F IIG + + Sbjct: 373 GVRLFLRYLGYGCGSDGALPYCVLMDLFACVGGVINIARVPEKWFPGQFDIIGNSHQIMH 432 Query: 502 TRSIQRGVFLHL 537 S+ +FLHL Sbjct: 433 VLSVISVIFLHL 444 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,695,262 Number of Sequences: 59808 Number of extensions: 383416 Number of successful extensions: 878 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -