BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1070 (767 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 25 1.9 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 2.6 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 25.4 bits (53), Expect = 1.9 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +1 Query: 619 PRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIESD 765 P A S A +P LDV+ AP P + D P VT E+ +ESD Sbjct: 283 PAATSAPLAFKVP-LDVLP---APFPGPSTDEPRTVTRKRTTESDVESD 327 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.0 bits (52), Expect = 2.6 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +1 Query: 343 LNRRFLERRLTDDMLRKRVSITADACTDSAAHKCNYELFNR 465 +++ + + ++L +I +D DS+ CN E FN+ Sbjct: 620 ISKELTKASIIQEILNIPTTIASDVAFDSSDFPCNSEEFNK 660 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 802,452 Number of Sequences: 2352 Number of extensions: 17231 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -