BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1067 (798 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 25 2.7 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 24 4.7 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 6.3 AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. 23 8.3 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 8.3 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 496 TSPLSRLERNTVRPPILSTAHRF 564 +SP++ R T R P ST HR+ Sbjct: 296 SSPIATRNRFTTRTPATSTEHRY 318 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 24.2 bits (50), Expect = 4.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 495 HVTTLTLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 605 HV+ +T+ ++ AP D A + RVS + V+V Sbjct: 819 HVSAVTIMSRTHAPGDAPHIADVKEQRVSGFVVSVLV 855 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = +3 Query: 432 PPGSVLEP-DHAGVLNGD 482 PPGS+L+P D A V+ G+ Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109 >AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. Length = 56 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 4/24 (16%) Frame = -3 Query: 457 SGSRTLP----GGEFDWGGTSVKE 398 +G+RT+P GG F GGT +K+ Sbjct: 21 TGARTVPRVFIGGNFVGGGTDIKK 44 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 8.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 411 VPPQSNSPPGSVLEPD 458 +PP SNS P S PD Sbjct: 868 MPPSSNSSPSSYPSPD 883 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 836,448 Number of Sequences: 2352 Number of extensions: 17501 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -