BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1055 (574 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A2.11 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 1.5 SPAC17A2.01 |bsu1|SPAC1B1.05, bsu1|high-affinity import carrier ... 25 7.9 >SPAC17A2.11 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 217 Score = 27.5 bits (58), Expect = 1.5 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 263 NFFAEYSSILFIRMILVIINMGGYNLRFFFYLKLRLISFL 144 NFF Y I+ + I ++ ++ FF +L L+SF+ Sbjct: 156 NFFLLYHQIILSHSLFHISHLISFHFLFFSFLSFPLLSFI 195 >SPAC17A2.01 |bsu1|SPAC1B1.05, bsu1|high-affinity import carrier for pyridoxine, pyridoxal, and pyridoxamine Bsu1|Schizosaccharomyces pombe|chr 1|||Manual Length = 526 Score = 25.0 bits (52), Expect = 7.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 324 SAKSKGVRFVSANKEEKKHRNKGIIIDINQTIS 422 S++S G+ ++ +EKK +IDI+ IS Sbjct: 33 SSQSDGIHETNSEYDEKKREESPEVIDISNLIS 65 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,343,376 Number of Sequences: 5004 Number of extensions: 20049 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -