BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1055 (574 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0799 + 25334460-25334994,25335060-25335236,25335325-253354... 27 8.0 >01_05_0799 + 25334460-25334994,25335060-25335236,25335325-25335447, 25335559-25335624,25335717-25336685,25336791-25336912, 25337156-25337549,25337888-25338009,25338253-25338646, 25338983-25339104,25339348-25339830,25340291-25340960, 25341713-25342224,25342484-25342540 Length = 1581 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +3 Query: 255 KKIKANPPLLYSILNPETNSLSPSAKSKGVRFVSANKEEKKHRNK 389 KK A P +++ P T SLS ++ R K+ ++ RN+ Sbjct: 72 KKAAAITPCSGTLMQPTTASLSMGSEVVNARLAETTKDAREERNR 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,211,898 Number of Sequences: 37544 Number of extensions: 91836 Number of successful extensions: 193 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -