BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1050 (611 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X65633-1|CAA46587.1| 297|Homo sapiens candidate adrenocorticot... 31 3.2 BC104170-1|AAI04171.1| 296|Homo sapiens MC2R protein protein. 31 3.2 BC104169-1|AAI04170.1| 297|Homo sapiens melanocortin 2 receptor... 31 3.2 BC094710-1|AAH94710.1| 297|Homo sapiens melanocortin 2 receptor... 31 3.2 BC069074-1|AAH69074.1| 297|Homo sapiens melanocortin 2 receptor... 31 3.2 AY225229-1|AAO67714.1| 297|Homo sapiens melanocortin 2 receptor... 31 3.2 AB065915-1|BAC06130.1| 297|Homo sapiens seven transmembrane hel... 31 3.2 >X65633-1|CAA46587.1| 297|Homo sapiens candidate adrenocorticotropic hormone receptor protein. Length = 297 Score = 31.1 bits (67), Expect = 3.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 239 GIGVTFFSFHTPVSYTISSLTPLLHISSFTQSIHFFL 349 GI + FS H P T +SL PL+ + +H FL Sbjct: 162 GITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFL 198 >BC104170-1|AAI04171.1| 296|Homo sapiens MC2R protein protein. Length = 296 Score = 31.1 bits (67), Expect = 3.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 239 GIGVTFFSFHTPVSYTISSLTPLLHISSFTQSIHFFL 349 GI + FS H P T +SL PL+ + +H FL Sbjct: 161 GITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFL 197 >BC104169-1|AAI04170.1| 297|Homo sapiens melanocortin 2 receptor (adrenocorticotropic hormone) protein. Length = 297 Score = 31.1 bits (67), Expect = 3.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 239 GIGVTFFSFHTPVSYTISSLTPLLHISSFTQSIHFFL 349 GI + FS H P T +SL PL+ + +H FL Sbjct: 162 GITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFL 198 >BC094710-1|AAH94710.1| 297|Homo sapiens melanocortin 2 receptor (adrenocorticotropic hormone) protein. Length = 297 Score = 31.1 bits (67), Expect = 3.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 239 GIGVTFFSFHTPVSYTISSLTPLLHISSFTQSIHFFL 349 GI + FS H P T +SL PL+ + +H FL Sbjct: 162 GITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFL 198 >BC069074-1|AAH69074.1| 297|Homo sapiens melanocortin 2 receptor (adrenocorticotropic hormone) protein. Length = 297 Score = 31.1 bits (67), Expect = 3.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 239 GIGVTFFSFHTPVSYTISSLTPLLHISSFTQSIHFFL 349 GI + FS H P T +SL PL+ + +H FL Sbjct: 162 GITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFL 198 >AY225229-1|AAO67714.1| 297|Homo sapiens melanocortin 2 receptor protein. Length = 297 Score = 31.1 bits (67), Expect = 3.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 239 GIGVTFFSFHTPVSYTISSLTPLLHISSFTQSIHFFL 349 GI + FS H P T +SL PL+ + +H FL Sbjct: 162 GITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFL 198 >AB065915-1|BAC06130.1| 297|Homo sapiens seven transmembrane helix receptor protein. Length = 297 Score = 31.1 bits (67), Expect = 3.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 239 GIGVTFFSFHTPVSYTISSLTPLLHISSFTQSIHFFL 349 GI + FS H P T +SL PL+ + +H FL Sbjct: 162 GITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFL 198 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,743,739 Number of Sequences: 237096 Number of extensions: 1951532 Number of successful extensions: 10690 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10690 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6522878360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -