BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1050 (611 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26440.1 68415.m03172 pectinesterase family protein contains ... 28 4.2 At5g52500.1 68418.m06513 expressed protein strong similarity to ... 28 5.6 >At2g26440.1 68415.m03172 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 547 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 255 FSPSILLYHTLFLRSLPSYTYRPSRNPSISS 347 F+ S LL+ F S+ SY+Y+PS NP +S Sbjct: 6 FNLSSLLFLLFFTPSVFSYSYQPSLNPHETS 36 >At5g52500.1 68418.m06513 expressed protein strong similarity to unknown protein (emb|CAB68146.1) Length = 363 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +3 Query: 267 ILLYHTLFLRSLPSYTYRPSRNPSISS*VYLFL 365 ILL+ TLFL +L ++ SR P+ISS + FL Sbjct: 49 ILLFLTLFLFTLSTFEEPSSRFPAISSPHWRFL 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,638,058 Number of Sequences: 28952 Number of extensions: 268719 Number of successful extensions: 632 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -