BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1044 (529 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0021 + 10681730-10681816,10681868-10681913,10682296-106823... 31 0.76 06_03_0151 + 17270688-17270698,17271149-17271281,17271548-172715... 30 1.0 10_01_0228 + 2417187-2418061,2418127-2418319,2419011-2419025,241... 29 3.1 02_03_0382 + 18352508-18352841,18353817-18354028,18354190-183542... 29 3.1 10_08_0307 - 16654691-16654890,16656230-16656698 28 4.0 05_01_0600 + 5381879-5381995,5382061-5382216,5382521-5382604,538... 28 5.3 01_01_0400 + 3038298-3038863,3039057-3039411,3039504-3040232 28 5.3 03_02_0536 - 9284079-9286034 27 7.1 09_04_0570 - 18614227-18614574,18614729-18614842,18614933-186151... 27 9.3 06_03_0809 + 24814590-24816593 27 9.3 >06_02_0021 + 10681730-10681816,10681868-10681913,10682296-10682388, 10682802-10682888,10683297-10683331 Length = 115 Score = 30.7 bits (66), Expect = 0.76 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = +1 Query: 1 QRYRMKIALCLVLVILFQFRNCQEIPEEVSSEDEKLSEGEK 123 Q Y KIA C + + F PE V +DEK E EK Sbjct: 21 QLYITKIAFCYITKVTFVNTFDLACPESVQDDDEKRQESEK 61 >06_03_0151 + 17270688-17270698,17271149-17271281,17271548-17271589, 17271706-17271815,17271957-17272035,17272114-17272287, 17272386-17272466,17272761-17272988,17273067-17273402, 17273501-17273586,17273642-17273783,17274596-17274687, 17274770-17274904,17275142-17275304,17275393-17275482, 17275568-17275753,17276109-17276141,17276700-17276762, 17276839-17276901,17276983-17277042,17277258-17277410, 17277530-17277613,17278434-17278610,17278685-17278791, 17278858-17279071,17279158-17279261,17279926-17280061, 17280191-17280316,17280682-17280792,17280968-17281066, 17281367-17281633,17281707-17281822,17281853-17282084, 17282597-17282664,17282682-17282807,17282980-17283040 Length = 1495 Score = 30.3 bits (65), Expect = 1.0 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = -3 Query: 467 LEGRVRCHP--QSCYVNSERAPNRIEPRREGVV-AACLQFFESHHGVGLHCSDIG 312 +E +C P C+V + P+ I P ++ AC F + GLHC D G Sbjct: 423 MESGRQCGPVLMGCFVTVKAPPSSILPSGSSLLDKACETSFSEYELNGLHCQDTG 477 >10_01_0228 + 2417187-2418061,2418127-2418319,2419011-2419025, 2419859-2419975 Length = 399 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 Query: 401 IEPRREGVVAACLQFFESHHGVGLHCSDIG 312 +EP R G L F E H+ V L C+DIG Sbjct: 296 VEPGRHGAAPTILGFVEEHNEV-LLCTDIG 324 >02_03_0382 + 18352508-18352841,18353817-18354028,18354190-18354277, 18355017-18355474 Length = 363 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = +1 Query: 79 EEVSSEDEKLSEGEKKLSHNILAILEHYKQPDPTGLPGAKLPDPYP 216 E+ +DEK E EK S N + E K+ DP+ L A L YP Sbjct: 286 EKKEGDDEKEKEKEKDDS-NAAEVEEKDKEKDPSALAAANLYMHYP 330 >10_08_0307 - 16654691-16654890,16656230-16656698 Length = 222 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 80 RRCRVKMKNFRKAKKNSVIISWLFWSIINSRI 175 R C + ++ R+ K +++SW W NSR+ Sbjct: 87 RHCPLGVEKRRRVKSLLILVSWEIWKERNSRV 118 >05_01_0600 + 5381879-5381995,5382061-5382216,5382521-5382604, 5382708-5382833,5383801-5383845,5384423-5384554, 5384682-5384777,5384880-5385041,5385156-5385300, 5385753-5385825,5386002-5386062,5386419-5386529, 5386620-5387093,5387173-5387207,5387760-5388318 Length = 791 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 79 EEVSSEDEKLSEGEKKLSHNILAILEHYKQPDPTGL 186 E+V +D KLSE L +L+IL H+K+ + G+ Sbjct: 90 EQVLLDDVKLSEQVMDLIFFVLSILSHWKKENHLGV 125 >01_01_0400 + 3038298-3038863,3039057-3039411,3039504-3040232 Length = 549 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = +1 Query: 70 EIPEEVSSEDEKLSEGEKKLSH-----NILAILEHYKQPDPTGL 186 +I E+ + E E L++GE+K SH N++A +E + P+ L Sbjct: 410 KIEEQETPEKENLTKGEEKESHDMMLDNVVAKIEEQETPEKENL 453 >03_02_0536 - 9284079-9286034 Length = 651 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 76 PEEVSSEDEKLSEGEKKLSH-NILAILEHYKQPDPTGLPGAKLPDPYPVP 222 P E E K E E ++ L E YK+P+P + P+P P P Sbjct: 365 PREPEPEPVKEEEPEPDMNEIKALPAPEDYKEPEPEKVEEEVKPEPPPQP 414 >09_04_0570 - 18614227-18614574,18614729-18614842,18614933-18615130, 18615290-18615463,18615546-18615752,18615886-18616180, 18616269-18617275 Length = 780 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 440 EGDSERGLQVERDGKIRAENIVMTYRPA 523 EG ER VERDGK + + + Y PA Sbjct: 8 EGREERSTDVERDGK-QGKEVESDYEPA 34 >06_03_0809 + 24814590-24816593 Length = 667 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 139 ILAILEHYKQPDPTGLPGAKLPDPYPVPDV 228 +L L+H +PD T LP P P P P V Sbjct: 233 MLVPLKHRPKPDVTVLPEPGPPSPAPAPAV 262 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,486,525 Number of Sequences: 37544 Number of extensions: 269643 Number of successful extensions: 801 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1166441080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -