BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1043 (460 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.037 SB_47179| Best HMM Match : Carboxyl_trans (HMM E-Value=0) 34 0.065 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 33 0.11 SB_31503| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_4860| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 30 1.1 SB_53293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 1.8 SB_38269| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_17140| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_369| Best HMM Match : Pox_A32 (HMM E-Value=0.2) 29 2.4 SB_37336| Best HMM Match : Peptidase_S7 (HMM E-Value=2.7) 29 2.4 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) 28 3.2 SB_57636| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_56915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) 28 4.3 SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) 28 4.3 SB_18258| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_59448| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_50954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_50629| Best HMM Match : Extensin_2 (HMM E-Value=0.94) 27 5.6 SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) 27 5.6 SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_52337| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 27 5.6 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_24570| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_24169| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 27 5.6 SB_23100| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 27 7.5 SB_34755| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 27 7.5 SB_12626| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 27 7.5 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 27 7.5 SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_51717| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_32076| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 27 9.9 SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) 27 9.9 SB_42| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_46598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_37920| Best HMM Match : DUF755 (HMM E-Value=2.3) 27 9.9 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 34.7 bits (76), Expect = 0.037 Identities = 35/108 (32%), Positives = 40/108 (37%), Gaps = 3/108 (2%) Frame = -1 Query: 340 PTKRLPCTLTPHVRSPPRSEPG*G---RGATASTLQPDGAAHPKDAQPTEPSRRIEGSET 170 P R+P PH R PP P GA+ + P GA HP+ P P R+ T Sbjct: 527 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGT 586 Query: 169 SAVSGRQPVGPPRRCRWCPGIPRWTRTRLPGRDAIHRRPVALFTPRQR 26 P G P PG P RLP A H R P QR Sbjct: 587 PH-PRVPPPGAPHPKVPPPGAP---YQRLPYSGAYHPRLPPPGPPYQR 630 Score = 32.3 bits (70), Expect = 0.20 Identities = 32/100 (32%), Positives = 39/100 (39%), Gaps = 5/100 (5%) Frame = -1 Query: 340 PTKRLPCTLTPHVRSPPRSEPG---*GRGATASTLQPDGAAHPKDAQPTEPSRRI--EGS 176 P R+P PH R PP P GA + P GA HP+ P P R+ G+ Sbjct: 427 PHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGA 486 Query: 175 ETSAVSGRQPVGPPRRCRWCPGIPRWTRTRLPGRDAIHRR 56 V P G P + PG P R+P A H R Sbjct: 487 PHPRV---PPPGAPHQRVPPPGAP---HPRVPPPGAPHPR 520 Score = 32.3 bits (70), Expect = 0.20 Identities = 32/100 (32%), Positives = 39/100 (39%), Gaps = 5/100 (5%) Frame = -1 Query: 340 PTKRLPCTLTPHVRSPPRSEPG*G---RGATASTLQPDGAAHPKDAQPTEPSRRI--EGS 176 P R+P PH R PP P GA + P GA HP+ P P +R+ G+ Sbjct: 447 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGA 506 Query: 175 ETSAVSGRQPVGPPRRCRWCPGIPRWTRTRLPGRDAIHRR 56 V P G P PG P R+P A H R Sbjct: 507 PHPRV---PPPGAPHPRVPPPGAP---HPRVPPPGAPHPR 540 Score = 31.5 bits (68), Expect = 0.35 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = -1 Query: 340 PTKRLPCTLTPHVRSPPRSEPG*G---RGATASTLQPDGAAHPKDAQPTEPSRRI 185 P R+P PH R PP P GA + P GA+HP+ P P R+ Sbjct: 517 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRV 571 Score = 31.1 bits (67), Expect = 0.46 Identities = 33/108 (30%), Positives = 38/108 (35%), Gaps = 3/108 (2%) Frame = -1 Query: 340 PTKRLPCTLTPHVRSPPRSEPG*G---RGATASTLQPDGAAHPKDAQPTEPSRRIEGSET 170 P R+P PH R PP P GA + P GA HP+ P P R+ Sbjct: 487 PHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV--PPP 544 Query: 169 SAVSGRQPVGPPRRCRWCPGIPRWTRTRLPGRDAIHRRPVALFTPRQR 26 A R P PP P R+P A H R TP R Sbjct: 545 GAPHPRVP--PPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPR 590 Score = 30.7 bits (66), Expect = 0.61 Identities = 30/95 (31%), Positives = 37/95 (38%), Gaps = 3/95 (3%) Frame = -1 Query: 331 RLPCTLTPHVRSPPRSEPG*GR---GATASTLQPDGAAHPKDAQPTEPSRRIEGSETSAV 161 R+P P+ R+ P EP GAT + GA+HP+ P P R+ S Sbjct: 360 RVPPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQ 419 Query: 160 SGRQPVGPPRRCRWCPGIPRWTRTRLPGRDAIHRR 56 R P P R PG P R P A H R Sbjct: 420 RVRPPGAPHPRVP-PPGAP---HPRFPPPGAPHPR 450 Score = 29.5 bits (63), Expect = 1.4 Identities = 35/110 (31%), Positives = 41/110 (37%), Gaps = 8/110 (7%) Frame = -1 Query: 331 RLPCTLTPHVRSPPRSEPG*GR------GATASTLQPDGAAHPKDAQPTEPSRRI--EGS 176 R+P PH R PP PG GA + P GA HP+ P P R+ G+ Sbjct: 400 RVPPPGAPHPRVPP---PGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGA 456 Query: 175 ETSAVSGRQPVGPPRRCRWCPGIPRWTRTRLPGRDAIHRRPVALFTPRQR 26 V P G P PG P R+P A H R P QR Sbjct: 457 PHPRV---PPPGAPHPRVPPPGAP---HPRVPPPGAPHPRVPPPGAPHQR 500 >SB_47179| Best HMM Match : Carboxyl_trans (HMM E-Value=0) Length = 622 Score = 33.9 bits (74), Expect = 0.065 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 74 PTRQPGSGPAGYSGTPAAPSGRPDG 148 P +QP P GY G P+AP G P G Sbjct: 429 PPQQPSYPPGGYGGPPSAPYGAPPG 453 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 33.1 bits (72), Expect = 0.11 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 74 PTRQPGS-GPAGYSGTPAAPSGRPDGLPSRDGRR 172 P PG+ G GY G PA P GR DG+P GR+ Sbjct: 1845 PPGPPGAYGWKGYPGNPAGPPGR-DGIPGPPGRQ 1877 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +2 Query: 74 PTRQPG-SGPAGYSGTPAAPSGR--PDGLPSRDG 166 P PG G GY G PA P GR P G P G Sbjct: 1696 PPGLPGPQGIPGYPGAPAGPPGRDGPMGPPGPSG 1729 >SB_31503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 32.7 bits (71), Expect = 0.15 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = -3 Query: 215 RPADGAFEANRRL*NVGRLGTAARRAAQTVPLVSRNTPLDQNQAAGS 75 + AD N +L NVG+L + A Q+ L ++ +DQNQ AGS Sbjct: 207 KAADCRCSKNHQLKNVGKLDISRSAANQSKHLEKQSLQVDQNQRAGS 253 >SB_4860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 30.7 bits (66), Expect = 0.61 Identities = 28/92 (30%), Positives = 38/92 (41%), Gaps = 6/92 (6%) Frame = -1 Query: 337 TKRLPCTLTPHVRSPPRSEPG*GRGATASTLQPDGAAHPKDAQP----TEPSRRIEGSET 170 T L C TP+ + P R+ R T +T + + K P T P+R I+G E Sbjct: 2 TNYLTCAATPYAKQPARAT--FHRVCTETTRREASSEKGKPYHPVCAVTNPARSIQG-EN 58 Query: 169 SAVSGRQPVGPPRRCRWCPG--IPRWTRTRLP 80 SGR P R G +P TR+ P Sbjct: 59 RTESGRMLCNNPARIHLGEGRNLPSHTRSNNP 90 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 29.9 bits (64), Expect = 1.1 Identities = 28/101 (27%), Positives = 37/101 (36%), Gaps = 9/101 (8%) Frame = -1 Query: 403 VRLNGLHGVVSRPRAQGF*DPPT--KRLP-CTLTPHVRSPPRSEPG*GRGATASTLQPDG 233 V+L L G +P PP +R P C H RS + P R +P Sbjct: 39 VQLKHLAGPAEKPHRPSRETPPVQPRRNPTCPAEKHHRSSKETPPVQPRNLAGPAEKPHR 98 Query: 232 AAHPKD-AQPTEPSRRIE-----GSETSAVSGRQPVGPPRR 128 + AQP P+ E ET V R P GP ++ Sbjct: 99 SRRETQLAQPRNPTSPAEKPHQSSKETQPVQQRNPAGPAKK 139 >SB_53293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 413 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = -2 Query: 300 DRLRGQNPDEVGGLPRQHYNQTARLTPRTPSRRSLRGESKALK 172 D QN VGG P Q Y A L P + +SLR SK K Sbjct: 187 DATNSQN-SAVGGAPCQEYTSRANLNPGPTASQSLRTLSKMEK 228 >SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +2 Query: 77 TRQPGSGPAGYSGTPAAPSGRPDGLPSRDGR 169 TR P SGP+G G+P P GR GR Sbjct: 718 TRGPVSGPSGARGSPHQPRGRASSPGGARGR 748 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +2 Query: 2 AARYQQSSALPWSE*SDRSTVYRVPTRQPGSGPAGYSGTPAAPSGRPDGLPSRDGRR 172 A R+ + + P E S +T+ QPGSG + ++P GR S+ G R Sbjct: 621 APRHSKPLSTPRGESSSPNTIPDRVRNQPGSGNSSPRSGASSPLGRASSPNSKKGSR 677 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +2 Query: 74 PTRQPGS-GPAGYSGTPAAPSGR--PDGLPSRDG 166 P PG GP G+ G P P+G P GLP +G Sbjct: 65 PPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNG 98 Score = 28.7 bits (61), Expect = 2.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +2 Query: 74 PTRQPGSGPAGYSGTPAAPSGRPDGLPSRDG 166 P G G G G PA P G P+GLP +G Sbjct: 239 PGNPGGPGYQGNHGNPAGPQG-PNGLPGPNG 268 >SB_38269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = -2 Query: 360 PKDFRTHPLNDSPALLHPTSDRLRGQNPDEVGGLPRQHYNQTARLTPRTPSRRSLRGESK 181 P D + P +++ + P+S R R + D + + NQ+ P R+L G S Sbjct: 605 PPDLKDAPRSEAHSKRRPSSARARANSTDSDDSVFHESANQSETGADTRPRTRTLSGRSA 664 Query: 180 A 178 A Sbjct: 665 A 665 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 29.1 bits (62), Expect = 1.8 Identities = 29/97 (29%), Positives = 40/97 (41%), Gaps = 5/97 (5%) Frame = -1 Query: 346 DPPTKRLPCTLTPHVRSPPRSEPG*GRGATASTLQ---PDGAAHPKDAQPTEPSRRIEGS 176 D +K P + P + S P++ P R A +S+ P +A P + PS+ G Sbjct: 979 DFKSKEPPASRIPVLSSKPQASPTTDRRAASSSSNHSTPVNSAPPTPTKNATPSKGTPGQ 1038 Query: 175 ETSA--VSGRQPVGPPRRCRWCPGIPRWTRTRLPGRD 71 TS V+G G P PG P T GRD Sbjct: 1039 STSGTPVNGTPCKGTPLNS--TPGTPSQLST---GRD 1070 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 28.7 bits (61), Expect = 2.4 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -1 Query: 238 DGAAHPKDAQPTEPSRRIEGSETSAVSGRQPVGPPRRCR 122 DG P QPT+ I+ T + P GPP C+ Sbjct: 70 DGITSPNHTQPTQVLPTIQPPPTHPYRQQGPAGPPVTCQ 108 >SB_17140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1236 Score = 28.7 bits (61), Expect = 2.4 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = -1 Query: 232 AAHPKDAQPTEPSRRIEGSETSAVSGRQPVGPPRRCRWCPGIPRWTRTRLPGRDAIHRR 56 A HP + P+E I+ + TSA G P P G P TR + G ++ R+ Sbjct: 973 AGHPNEVVPSEQKMGIQSTGTSA--GTTPRTPSLTRNQTGGAPSLTRKQTGGAASLTRK 1029 >SB_369| Best HMM Match : Pox_A32 (HMM E-Value=0.2) Length = 856 Score = 28.7 bits (61), Expect = 2.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 86 PGSGPAGYSGTPAAPSGRPD 145 PG G G+SG PAAP+ P+ Sbjct: 332 PGGGGGGHSGAPAAPAIGPE 351 >SB_37336| Best HMM Match : Peptidase_S7 (HMM E-Value=2.7) Length = 481 Score = 28.7 bits (61), Expect = 2.4 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 Query: 6 RATSNLARCRGVNRATGRRCIASRPGSLVLVQRGIPGHQRHRLGGP 143 ++ L+ C +NR T A PG + R PGH+R RL P Sbjct: 261 QSLKRLSICWPLNRETFE---ALEPGGFIESDRSAPGHRRGRLSEP 303 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.3 bits (60), Expect = 3.2 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -1 Query: 250 TLQPDGAAHPKDAQPTEPSRRIEGSETSAVSGRQPVGPPRRCRWCPG---IPRWTRT 89 ++Q DGA P QP R+I S A G Q P R PG +P W RT Sbjct: 622 SVQRDGARQPSSTQPAGQKRQI--SAPMASGGAQASKAPMRP--APGKIELPDWPRT 674 >SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) Length = 493 Score = 28.3 bits (60), Expect = 3.2 Identities = 42/145 (28%), Positives = 58/145 (40%), Gaps = 4/145 (2%) Frame = -3 Query: 455 RGPNLLRDPRAKGARGVCETQRSAWCCEQTAGPRI---LGPTH*TTPLHSYTPRPIASEV 285 R NLL A A G RS+ A P + LG T P S+TPR S Sbjct: 282 RRANLLEALTAAAA-GTPAASRSSSSSISLASPGMRSSLGSLQRTPP--SFTPRSSISRR 338 Query: 284 RTRMR*GGYRVNTTTRRRGSPQGRPADGAFEANRRL*N-VGRLGTAARRAAQTVPLVSRN 108 R+ T RRR + R + + RR + +GR+ T + + V L+ Sbjct: 339 RSD--------TPTKRRRMHREHRSGERVLLSRRRPASAMGRITTKKKTPPRRVNLLEAF 390 Query: 107 TPLDQNQAAGSGRDTPSTGRSIHST 33 T AGS R + S+ S+ ST Sbjct: 391 TAAAAGTPAGSRRSSSSSRSSLPST 415 >SB_57636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 98 PAGYSGTPAAPSGRPDGL 151 P G+SG PAAP+ PD L Sbjct: 264 PGGHSGAPAAPAIGPDSL 281 >SB_56915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 720 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = -1 Query: 382 GVVSRPRAQGF*DPPTKRLPCTLTPHVRSPPRSEPG*G--RGATASTLQPDGAAHPKDAQ 209 G++SR A P +R+P T+TP + P S G + P + D Q Sbjct: 352 GIISRRSAFRPWSPVGQRIPPTITPFDKLPVPSPNGVAFLPSGSGRIFSPTAVTYQSDCQ 411 Query: 208 PTEPSRRIEGS 176 +P+ +GS Sbjct: 412 CNDPACEHKGS 422 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 27.9 bits (59), Expect = 4.3 Identities = 22/81 (27%), Positives = 27/81 (33%), Gaps = 2/81 (2%) Frame = -1 Query: 370 RPRAQGF*DPPTKRLPCTLTPHVRSPPRSEPG*GRGATASTLQPDGA--AHPKDAQPTEP 197 +P+ G PPT P PP S G + S P +P P P Sbjct: 946 QPQPPGIMQPPTSIPPSQPMAPPSFPPSSMGGFPPSSQPSMYNPGQVQPGYPGAMTPGAP 1005 Query: 196 SRRIEGSETSAVSGRQPVGPP 134 S + SG P GPP Sbjct: 1006 SPGVPSPTGLPPSGPPPTGPP 1026 >SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) Length = 942 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = -1 Query: 343 PPTKRLPCTLTPHVRSPPRSEPG*GRGATASTLQPDGAAHPKDAQPTEPSRRIEGSETSA 164 P +P + TP R+PP S + S+ QP A P + P ++++ ++A Sbjct: 204 PTGHGIPPSSTPQARAPPHSSTQPLSSHSGSSPQPGSAFSPVNTPPNAQAQQMTPPSSAA 263 >SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) Length = 933 Score = 27.9 bits (59), Expect = 4.3 Identities = 21/68 (30%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Frame = -1 Query: 331 RLPCTLTPHVRSPPRSEPG*GRGATASTLQPDGAAHPKDA-QPTEPSRRIEGSETSAVSG 155 R P +P P RS P R +S P GA P+D +P + G Sbjct: 481 RSPGYYSPLRDKPARSSPLAFREQPSSASTPSGARPPRDTDRPFTTVAMPTPPLENTGEG 540 Query: 154 RQPVGPPR 131 R P+ PPR Sbjct: 541 RSPLPPPR 548 >SB_18258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Frame = +3 Query: 171 VSEPSIRLEGSVGWASLG*AAPSGCSVD----AVAPLPHPGSDLGGDRTWGVRVQGSRLV 338 V P I +GSV W S+G + S + D A+ G LG W V +G ++ Sbjct: 215 VRGPDINDDGSVWWVSVGERSASAGARDGPRGAIVANHRGGRALGAQDRWVVSQKGGQIA 274 Query: 339 GGS 347 G+ Sbjct: 275 VGA 277 >SB_59448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.5 bits (58), Expect = 5.6 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -1 Query: 253 STLQPDGAAHPKDAQPTEPSRRIEGSETSAVSGRQP 146 S +P AHP+ + PTEP++R+ A S R+P Sbjct: 57 SDTEPTHRAHPQ-SPPTEPTQRLPRDGHPAPSKRRP 91 >SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1853 Score = 27.5 bits (58), Expect = 5.6 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 4/30 (13%) Frame = +2 Query: 95 GPAGYSGTPAAPSGRPD----GLPSRDGRR 172 GP G G P P R D GLP DG R Sbjct: 915 GPRGRDGLPGEPGARGDIGSRGLPGEDGPR 944 >SB_50954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 768 Score = 27.5 bits (58), Expect = 5.6 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 47 SDRSTVYRVPTRQPGSGPAGYSGTPAAPSGRPDGLPSRDG 166 +D S + T+ G+GP+G G G PSR G Sbjct: 41 ADASVAVDLGTQDEGAGPSGVQGDDTIRPALDGGKPSRGG 80 >SB_50629| Best HMM Match : Extensin_2 (HMM E-Value=0.94) Length = 450 Score = 27.5 bits (58), Expect = 5.6 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -2 Query: 309 PTSDRLRGQNPDEVGGLPRQHYNQTARLTPR----TPSRRS 199 P S R R Q+P V PR+ ++PR TP+R S Sbjct: 368 PVSQRQRSQSPQRVQASPRRRSQSPDHVSPRRKSQTPNRAS 408 >SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) Length = 513 Score = 27.5 bits (58), Expect = 5.6 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -3 Query: 329 TPLHSYTPRPIASEVRTRMR*GGYRVNTTTRRRGSPQGR 213 TP S+TP+ S R+ G R++ RR GS QGR Sbjct: 346 TP-QSFTPQSSISRRRSDTPKGRRRISVPRRRAGSAQGR 383 >SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 27.5 bits (58), Expect = 5.6 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 10/89 (11%) Frame = -1 Query: 373 SRPRAQGF*DPPTKRLPCTLTPHVRSPPRSEPG*GRGATASTLQ-PDGAAH-PKD----- 215 ++P+ G P + T S P PG G+ T T Q P G +H P+D Sbjct: 673 TKPKPSGPSHKPGDQATTLGTKAQSSGPSHNPG-GQATTLETKQQPWGPSHNPRDQATTL 731 Query: 214 ---AQPTEPSRRIEGSETSAVSGRQPVGP 137 +QP+ PS+ I T+ + +P GP Sbjct: 732 GTKSQPSGPSQNIGDQATTLGTKPKPSGP 760 >SB_52337| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 591 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 98 PAGYSGTPAAPSGRPDGLPS 157 P G+SGTPAAP+ P+ S Sbjct: 332 PGGHSGTPAAPAVGPESFYS 351 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 86 PGSGPAGYSGTPAAPSGRPD 145 PG G G SG PAAP+ P+ Sbjct: 516 PGGGGGGGSGAPAAPAVSPE 535 >SB_24570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 502 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 98 PAGYSGTPAAPSGRPDGL 151 P G+SG PAAP+ P+ L Sbjct: 210 PGGHSGAPAAPAVNPESL 227 >SB_24169| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 591 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 98 PAGYSGTPAAPSGRPDGLPS 157 P G+SGTPAAP+ P+ S Sbjct: 332 PGGHSGTPAAPAVGPESFYS 351 >SB_23100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 5.6 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = +3 Query: 60 RCIASRPGS-LVLVQRGIPGHQRHRLGGPTGCRPETADVSEPSIRLEGSVGWASLG*AAP 236 R S PG+ +V ++ G+PG+ RL G P DV +RLEGS+ ++ P Sbjct: 3 RLEGSLPGNNMVRLEGGLPGNNMVRLKGGL---PRN-DV----VRLEGSLPGNNMVKLGP 54 Query: 237 SGCSVDAVAPLPHPG 281 SV+ AP H G Sbjct: 55 VLLSVNTYAPHTHQG 69 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 74 PTRQPGSGPAGYSGTPAAPSGRPDG 148 P P + P SG P +P+G P G Sbjct: 707 PPPPPSTPPVQQSGAPGSPAGSPSG 731 >SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 95 GPAGYSGTPAAPSGRPDGLPSRDGRR 172 G G G P +P P G P +DGRR Sbjct: 150 GQRGRRGNPGSPG--PKGTPGKDGRR 173 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 27.1 bits (57), Expect = 7.5 Identities = 24/83 (28%), Positives = 29/83 (34%), Gaps = 2/83 (2%) Frame = -1 Query: 373 SRPRAQGF*DPPTKRLPCTLTPHVRS--PPRSEPG*GRGATASTLQPDGAAHPKDAQPTE 200 SR G PP R P RS PP PG G + P G++ P A P Sbjct: 187 SRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPG 246 Query: 199 PSRRIEGSETSAVSGRQPVGPPR 131 +R G P PP+ Sbjct: 247 ENRPPPPMRGPTSGGEPP--PPK 267 >SB_34755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -3 Query: 449 PNLLRDPRAKGARGVCETQRSAWCCE-QTAGP 357 PN + A+G RG+C+ C E +TA P Sbjct: 61 PNTIGCSSARGPRGICDVNPLVQCAEPKTASP 92 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/51 (29%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = -1 Query: 340 PTKRLPCTLTPHVRSPPRSEPG*GRGATA---STLQPDGAAHPKDAQPTEP 197 P PCT PH PP ++P + T +T P H T+P Sbjct: 126 PHTTKPCTTKPHTTKPPTTKPQTTKPHTTKPRTTKPPTTKPHTTKPHTTKP 176 >SB_12626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 363 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 62 VYRVPTRQPGSGPAGYSGTPAAPSGRPDG 148 V VP +P P G G P P GRP G Sbjct: 277 VLLVPIGRPIGRPIGLIGRPIGPIGRPIG 305 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 27.1 bits (57), Expect = 7.5 Identities = 24/83 (28%), Positives = 29/83 (34%), Gaps = 2/83 (2%) Frame = -1 Query: 373 SRPRAQGF*DPPTKRLPCTLTPHVRS--PPRSEPG*GRGATASTLQPDGAAHPKDAQPTE 200 SR G PP R P RS PP PG G + P G++ P A P Sbjct: 99 SRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPG 158 Query: 199 PSRRIEGSETSAVSGRQPVGPPR 131 +R G P PP+ Sbjct: 159 ENRPPPPMRGPTSGGEPP--PPK 179 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -1 Query: 340 PTKRLPCTLTPHVRSPPRSEPG*GRGA-TASTLQPDGAAHPKDAQPTEPSRRIEGS 176 P +P T TPH PP P + + T + ++P P+ PS I+ S Sbjct: 279 PHTSIPPTPTPHTSIPPTPHPTYKHPSYSYPTYKHPSYSYPSYKHPSYPSSHIQAS 334 >SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 957 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 86 PGSGPAGYSGTPAAPSGRPD 145 PGS P G+SG PAAP+ P+ Sbjct: 322 PGS-PGGHSGAPAAPAIGPE 340 >SB_51717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 26.6 bits (56), Expect = 9.9 Identities = 39/139 (28%), Positives = 56/139 (40%), Gaps = 2/139 (1%) Frame = -3 Query: 455 RGPNLLRDPRAKGARGVCETQRSAWCCEQTAGPRI-LGPTH*TTPLHSYTPRPIASEVRT 279 R NLL A A ++ S+ + G R LG T P S+TPR S R+ Sbjct: 570 RRANLLEALTAAAAGTPAASRSSSSVSLASPGMRSSLGSLQLTPP--SFTPRSSISRRRS 627 Query: 278 RMR*GGYRVNTTTRRRGSPQGRPADGAFEANRRL*N-VGRLGTAARRAAQTVPLVSRNTP 102 T RRR + R + + RR + +GR+ T + + V L+ T Sbjct: 628 D--------TPTKRRRMHREHRSGERVLLSRRRPASAMGRITTKKKTPPRRVNLLEAFTA 679 Query: 101 LDQNQAAGSGRDTPSTGRS 45 AGS R + S+ RS Sbjct: 680 AAAGTPAGSRRRSSSSSRS 698 >SB_32076| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 2352 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 92 SGPAGYSGTPAAPSGRPD 145 S P G+SG PAAP+ P+ Sbjct: 1621 SSPGGHSGAPAAPAVGPE 1638 >SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) Length = 1566 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -1 Query: 370 RPRAQGF*DPPTKRLPCTLTPHVRSPPRSEPG*GRGATASTLQP--DGAAHPKDAQ 209 +PR+ G+ DP K T RS ++P + +T +P DG PKD + Sbjct: 253 KPRSDGWTDPKDKEFVSMATDKPRSDGWTDPKDKEFVSMATDKPRSDGWTDPKDKE 308 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -1 Query: 370 RPRAQGF*DPPTKRLPCTLTPHVRSPPRSEPG*GRGATASTLQP--DGAAHPKDAQ 209 +PR+ G+ DP K T RS ++P + +T +P DG PKD + Sbjct: 295 KPRSDGWTDPKDKEFVSMATDKPRSDGWTDPKDKEFVSMATDKPRSDGWTDPKDKE 350 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -1 Query: 370 RPRAQGF*DPPTKRLPCTLTPHVRSPPRSEPG*GRGATASTLQP--DGAAHPKDAQ 209 +PR+ G+ DP K T RS ++P + +T +P DG PKD + Sbjct: 337 KPRSDGWTDPKDKEFVSMATDKPRSDGWTDPKDKEFVSMATDKPRSDGWTDPKDKE 392 >SB_42| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1207 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = -1 Query: 319 TLTPHVRSPPRSEPG*GRGATASTLQPDGAAHPKDAQPTEPSRRIEGSETSAVSG 155 T+ + + PR G + PDG+ PKD P E ++GS A++G Sbjct: 917 TINTNQSTLPREPVNEGYDNPTFSDYPDGSPSPKDVSP-ESGVSLDGSNGPALNG 970 >SB_46598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1910 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 83 QPGSGPAGYSGTPAAPSGRPD 145 +P G G+SG PAAP+ P+ Sbjct: 1088 RPSLGGGGHSGAPAAPAVSPE 1108 >SB_37920| Best HMM Match : DUF755 (HMM E-Value=2.3) Length = 193 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -1 Query: 220 KDAQPTEPSRRIEGSETSAVSGRQPVGPPRRCRWCPGIPRWTRTR 86 K+ +P +P R ++ S V ++ P R+ R PR TRTR Sbjct: 84 KEIKP-KPKRTLKRSAELTVVKKEATSPVRKTRATATAPRATRTR 127 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,099,195 Number of Sequences: 59808 Number of extensions: 409189 Number of successful extensions: 1629 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 1390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1596 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -