Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm1038
         (457 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A6CKE6 Cluster: HAD-superfamily subfamily IB, PSPase-li...    32   6.7  

>UniRef50_A6CKE6 Cluster: HAD-superfamily subfamily IB, PSPase-like
           protein; n=1; Bacillus sp. SG-1|Rep: HAD-superfamily
           subfamily IB, PSPase-like protein - Bacillus sp. SG-1
          Length = 223

 Score = 31.9 bits (69), Expect = 6.7
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)
 Frame = +2

Query: 197 QINSVKLRT--LAFDQN*TCTGYITHLNNNELNVLKKIEF 310
           Q+N V + +  L FDQN  CTG I H+ N ++ V K  E+
Sbjct: 128 QLNDVHVLSTELQFDQNGKCTGEIGHIVNGDVKVTKLQEW 167


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 407,888,277
Number of Sequences: 1657284
Number of extensions: 7125882
Number of successful extensions: 12838
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12563
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12835
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 23931581955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)