BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbVm1038
(457 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A6CKE6 Cluster: HAD-superfamily subfamily IB, PSPase-li... 32 6.7
>UniRef50_A6CKE6 Cluster: HAD-superfamily subfamily IB, PSPase-like
protein; n=1; Bacillus sp. SG-1|Rep: HAD-superfamily
subfamily IB, PSPase-like protein - Bacillus sp. SG-1
Length = 223
Score = 31.9 bits (69), Expect = 6.7
Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)
Frame = +2
Query: 197 QINSVKLRT--LAFDQN*TCTGYITHLNNNELNVLKKIEF 310
Q+N V + + L FDQN CTG I H+ N ++ V K E+
Sbjct: 128 QLNDVHVLSTELQFDQNGKCTGEIGHIVNGDVKVTKLQEW 167
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 407,888,277
Number of Sequences: 1657284
Number of extensions: 7125882
Number of successful extensions: 12838
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12563
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12835
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 23931581955
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -