BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1036 (502 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 29 0.018 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 3.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 3.6 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 8.2 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.2 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.2 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 29.5 bits (63), Expect = 0.018 Identities = 18/64 (28%), Positives = 28/64 (43%) Frame = +3 Query: 129 CAHCPLSSRETCRASCINESANARGEAVCVLGALPLPRSLTRALGRSAAASGISSLKGGN 308 C CP ++++ R CI N R + V +P P S+ LG ++ L + Sbjct: 73 CYDCPYNTQDCYREDCIPGDGNKR-SIIVVNRKMPGP-SVEVCLGDEVIIDVVNHLSSDS 130 Query: 309 TVIH 320 T IH Sbjct: 131 TTIH 134 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 3.6 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 Query: 272 CGERYQLTQRR*YGYPQNQGITQERTCEQKASKRPGT 382 C R QLT RR + P R C + PGT Sbjct: 590 CRPREQLTWRRNFHGPHRLAARSRRCCYHAVA--PGT 624 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 3.6 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 Query: 272 CGERYQLTQRR*YGYPQNQGITQERTCEQKASKRPGT 382 C R QLT RR + P R C + PGT Sbjct: 482 CRPREQLTWRRNFHGPHRLAARSRRCCYHAVA--PGT 516 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +1 Query: 193 TRGERRFAYWAL 228 +RGERRF++ AL Sbjct: 99 SRGERRFSHKAL 110 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +1 Query: 193 TRGERRFAYWAL 228 +RGERRF++ AL Sbjct: 259 SRGERRFSHKAL 270 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +1 Query: 193 TRGERRFAYWAL 228 +RGERRF++ AL Sbjct: 259 SRGERRFSHKAL 270 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.6 bits (41), Expect = 8.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +3 Query: 147 SSRETCRASCINESANARGEAVCVLGALPLPRSLTR 254 S+ T +S + N+ + + +PLPR L R Sbjct: 427 SNTNTSTSSTNSNKPNSSDLNMLIKETMPLPRKLVR 462 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,023 Number of Sequences: 336 Number of extensions: 2307 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -