BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1036 (502 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 130 5e-31 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 2e-30 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 3e-30 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 127 4e-30 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 127 6e-30 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 127 6e-30 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 127 6e-30 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 127 6e-30 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 126 8e-30 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 1e-22 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 4e-22 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 4e-22 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 7e-21 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 96 2e-20 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 96 2e-20 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 96 2e-20 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 96 2e-20 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 96 2e-20 SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) 96 2e-20 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 96 2e-20 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 86 2e-17 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 78 4e-15 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 68 5e-12 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 7e-12 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 7e-12 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 66 2e-11 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 3e-11 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 65 4e-11 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 64 5e-11 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 64 5e-11 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 64 5e-11 SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) 64 5e-11 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 64 8e-11 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 64 8e-11 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 63 1e-10 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 63 1e-10 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 63 1e-10 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 63 1e-10 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 63 1e-10 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 63 1e-10 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 63 1e-10 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 63 1e-10 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 63 1e-10 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 63 1e-10 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 63 1e-10 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 63 1e-10 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 63 1e-10 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 63 1e-10 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 63 1e-10 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 63 1e-10 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 63 1e-10 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 63 1e-10 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 63 1e-10 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 63 1e-10 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 63 1e-10 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 63 1e-10 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 63 1e-10 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 63 1e-10 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 63 1e-10 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 63 1e-10 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 63 1e-10 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 63 1e-10 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 63 1e-10 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 63 1e-10 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 63 1e-10 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 63 1e-10 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 63 1e-10 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 63 1e-10 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 63 1e-10 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 63 1e-10 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 63 1e-10 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 63 1e-10 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 63 1e-10 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 63 1e-10 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 63 1e-10 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 63 1e-10 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 63 1e-10 SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 63 1e-10 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4) 63 1e-10 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 63 1e-10 SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22) 63 1e-10 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 63 1e-10 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 63 1e-10 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 63 1e-10 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 63 1e-10 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 63 1e-10 SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) 63 1e-10 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) 63 1e-10 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 63 1e-10 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 63 1e-10 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 63 1e-10 SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) 63 1e-10 SB_3948| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 4e-10 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 61 4e-10 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 61 4e-10 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 61 4e-10 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 61 4e-10 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 61 6e-10 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 61 6e-10 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 60 8e-10 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 8e-10 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 60 8e-10 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 60 8e-10 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 8e-10 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 60 8e-10 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 60 1e-09 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 60 1e-09 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 60 1e-09 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 60 1e-09 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 60 1e-09 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 60 1e-09 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 60 1e-09 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 60 1e-09 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 60 1e-09 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 60 1e-09 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 60 1e-09 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 60 1e-09 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 60 1e-09 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 60 1e-09 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 60 1e-09 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 60 1e-09 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 60 1e-09 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 60 1e-09 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 60 1e-09 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 60 1e-09 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 60 1e-09 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 60 1e-09 SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7) 60 1e-09 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 60 1e-09 SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18550| Best HMM Match : DUF987 (HMM E-Value=4.4) 60 1e-09 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 60 1e-09 SB_16872| Best HMM Match : ARM_1 (HMM E-Value=0) 60 1e-09 SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 60 1e-09 SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 60 1e-09 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 60 1e-09 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 60 1e-09 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 60 1e-09 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 60 1e-09 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 60 1e-09 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 60 1e-09 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 60 1e-09 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 60 1e-09 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 60 1e-09 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) 60 1e-09 SB_870| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-09) 60 1e-09 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 59 2e-09 SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) 59 2e-09 SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 59 2e-09 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 59 2e-09 SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 59 2e-09 SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 59 2e-09 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) 59 2e-09 SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) 59 2e-09 SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 59 2e-09 SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) 59 2e-09 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 59 2e-09 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 59 2e-09 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 59 2e-09 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 59 2e-09 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 59 2e-09 SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) 59 2e-09 SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) 59 2e-09 SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) 59 2e-09 SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 59 2e-09 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 59 2e-09 SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) 59 2e-09 SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 59 2e-09 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 59 2e-09 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 59 2e-09 SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05) 59 2e-09 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_56823| Best HMM Match : Rhabdo_NV (HMM E-Value=7.4) 58 3e-09 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_54715| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) 58 3e-09 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 58 3e-09 SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) 58 3e-09 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 58 3e-09 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 58 3e-09 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 58 3e-09 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 130 bits (315), Expect = 5e-31 Identities = 59/62 (95%), Positives = 59/62 (95%) Frame = -1 Query: 439 DARQGGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 260 D QGGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 19 DVGQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 78 Query: 259 SA 254 SA Sbjct: 79 SA 80 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 128 bits (310), Expect = 2e-30 Identities = 59/69 (85%), Positives = 61/69 (88%) Frame = -1 Query: 433 RQGGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 254 ++GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA Sbjct: 757 KRGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 816 Query: 253 RVSERGSGR 227 S R Sbjct: 817 ASQNTSSIR 825 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 128 bits (308), Expect = 3e-30 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -1 Query: 430 QGGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 254 +GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA Sbjct: 405 EGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 463 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 127 bits (307), Expect = 4e-30 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -1 Query: 430 QGGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 254 +GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA Sbjct: 554 KGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 612 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 127 bits (306), Expect = 6e-30 Identities = 57/58 (98%), Positives = 57/58 (98%) Frame = -1 Query: 427 GGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 254 GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 58 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 127 bits (306), Expect = 6e-30 Identities = 57/58 (98%), Positives = 57/58 (98%) Frame = -1 Query: 427 GGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 254 GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 81 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 127 bits (306), Expect = 6e-30 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +2 Query: 320 QNQGITQERTCEQKASKRPGTVKRPRCWRXSIGSAPLTSITKIDAQVRSGETRQDYKDTR 499 +NQGITQERTCEQKASKRPGTVKRPRCWR SIGSAPLTSITKIDAQVR GETRQDYKDTR Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTR 173 Query: 500 R 502 R Sbjct: 174 R 174 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 127 bits (306), Expect = 6e-30 Identities = 57/58 (98%), Positives = 57/58 (98%) Frame = -1 Query: 427 GGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 254 GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 58 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 126 bits (305), Expect = 8e-30 Identities = 58/60 (96%), Positives = 58/60 (96%) Frame = +2 Query: 323 NQGITQERTCEQKASKRPGTVKRPRCWRXSIGSAPLTSITKIDAQVRSGETRQDYKDTRR 502 NQGITQERTCEQKASKRPGTVKRPRCWR SIGSAPLTSITKIDAQVR GETRQDYKDTRR Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 145 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 103 bits (246), Expect = 1e-22 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE*AD 285 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE D Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 102 bits (245), Expect = 1e-22 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 434 SSGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 +SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 57 NSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect = 2e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 101 bits (241), Expect = 4e-22 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF+ Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 101 bits (241), Expect = 4e-22 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 +GGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 92 AGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 137 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 97.1 bits (231), Expect = 7e-21 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 425 GRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 GRSLWK ASNAAFLRFLAFCWPFAHMF+PALSPDSVDNRITAFE Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) Length = 183 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 336 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 95.9 bits (228), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 3e-19 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = -3 Query: 431 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 SGGRSLWK ASNAAFLRFLAF WPFAHMFF ALSPD VDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 86.6 bits (205), Expect = 1e-17 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -3 Query: 425 GRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 G K ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 18 GAEPMKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 85.8 bits (203), Expect = 2e-17 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -3 Query: 425 GRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 294 GRSLWK ASNAAFLRFLAFCWPF HMF PALSPDSVD ITAFE Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFE 45 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 78.2 bits (184), Expect = 4e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 144 LSSRETCRASCINESANARGEAVCVLGALPLPRSLTR 254 L+SRETCRASCINESANARGEAVCVLGALPLPRSLTR Sbjct: 90 LNSRETCRASCINESANARGEAVCVLGALPLPRSLTR 126 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 257 ARSFGCGERYQLTQRR 304 ARSFGCGERYQLTQRR Sbjct: 128 ARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 74.5 bits (175), Expect = 4e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 153 RETCRASCINESANARGEAVCVLGALPLPRSLTR 254 RETCRASCINESANARGEAVCVLGALPLPRSLTR Sbjct: 457 RETCRASCINESANARGEAVCVLGALPLPRSLTR 490 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 257 ARSFGCGERYQLTQRR 304 ARSFGCGERYQLTQRR Sbjct: 492 ARSFGCGERYQLTQRR 507 >SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) Length = 300 Score = 67.7 bits (158), Expect = 5e-12 Identities = 37/68 (54%), Positives = 42/68 (61%), Gaps = 3/68 (4%) Frame = +1 Query: 34 LSAHNSTQHTSRKHKV*SLGCLMSE---LTHINCVALTARFPVGKPVVPAALMNRPTRGE 204 +S + QH S KHK + GC E + + T VGKPVVPAALMNRPTRGE Sbjct: 155 ISGEYAVQH-SCKHKAFTEGCKEPEGPKHRYFRRICCTTLLQVGKPVVPAALMNRPTRGE 213 Query: 205 RRFAYWAL 228 RRFAYWAL Sbjct: 214 RRFAYWAL 221 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 67.3 bits (157), Expect = 7e-12 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +1 Query: 88 LGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 L C+ S++ I+ V L PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 22 LNCVPSKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYWAL 67 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 67.3 bits (157), Expect = 7e-12 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 124 CVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 C++ T F VGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 129 CISFTRIFRVGKPVVPAALMNRPTRGERRFAYWAL 163 >SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 66.5 bits (155), Expect = 1e-11 Identities = 37/59 (62%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = +1 Query: 55 QHTSRKHKV*S-LGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 +H +RK K+ S L M ++ I+ V L PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 102 EHKTRKTKLLSTLPPRMRKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYWAL 159 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 66.1 bits (154), Expect = 2e-11 Identities = 45/82 (54%), Positives = 48/82 (58%) Frame = +2 Query: 257 ARSFGCGERYQLTQRR*YGYPQNQGITQERTCEQKASKRPGTVKRPRCWRXSIGSAPLTS 436 ARSF CGER LT G E +K R V+ PR R SIGSAPLTS Sbjct: 113 ARSFDCGERKWLTN--------GGGDFLEDA--RKILNRE--VRGPRQSRFSIGSAPLTS 160 Query: 437 ITKIDAQVRSGETRQDYKDTRR 502 ITK DAQ+ GETRQDYKDTRR Sbjct: 161 ITKSDAQISGGETRQDYKDTRR 182 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYWAL 63 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 66.1 bits (154), Expect = 2e-11 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 112 THINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 T +C+ ++ + VGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 27 TGFHCILVSFGYSVGKPVVPAALMNRPTRGERRFAYWAL 65 >SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 3e-11 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 94 CLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 C+ S + I+ V L PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 19 CMKSVIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYWAL 62 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 64.9 bits (151), Expect = 4e-11 Identities = 38/67 (56%), Positives = 42/67 (62%) Frame = +1 Query: 28 KLLSAHNSTQHTSRKHKV*SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGER 207 K+L H T R+ G L E+ I+ V L PVGKPVVPAALMNRPTRGER Sbjct: 41 KVLGGHVLTYRLFRRDLA---GKLHIEIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGER 96 Query: 208 RFAYWAL 228 RFAYWAL Sbjct: 97 RFAYWAL 103 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 64.9 bits (151), Expect = 4e-11 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +1 Query: 97 LMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 +M + + VA AR VGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 208 IMKKSGSVQIVAELAREYVGKPVVPAALMNRPTRGERRFAYWAL 251 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 64.5 bits (150), Expect = 5e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 130 ALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 A+ P+GKPVVPAALMNRPTRGERRFAYWAL Sbjct: 173 AINTTLPIGKPVVPAALMNRPTRGERRFAYWAL 205 >SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) Length = 753 Score = 64.5 bits (150), Expect = 5e-11 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 142 RFPVGKPVVPAALMNRPTRGERRFAYWAL 228 R P+GKPVVPAALMNRPTRGERRFAYWAL Sbjct: 212 RIPIGKPVVPAALMNRPTRGERRFAYWAL 240 >SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) Length = 145 Score = 64.5 bits (150), Expect = 5e-11 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = +1 Query: 61 TSRKHKV*SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 TSR+ L L++ ++ T R VGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 11 TSREFADMQLNPLVAHTILVHARTKTERTLVGKPVVPAALMNRPTRGERRFAYWAL 66 >SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) Length = 900 Score = 64.5 bits (150), Expect = 5e-11 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +1 Query: 91 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 G L + + + +T + VGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 826 GALPEVIESLPRIKITTQHTVGKPVVPAALMNRPTRGERRFAYWAL 871 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 64.1 bits (149), Expect = 6e-11 Identities = 35/64 (54%), Positives = 39/64 (60%), Gaps = 2/64 (3%) Frame = +1 Query: 43 HNSTQHTSRKHKV*SLGCLMSELTHINCVALT--ARFPVGKPVVPAALMNRPTRGERRFA 216 +N T+H R V S+ T I + PVGKPVVPAALMNRPTRGERRFA Sbjct: 4 YNCTRHIERNAAVSSIDNAKKIDTSIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFA 63 Query: 217 YWAL 228 YWAL Sbjct: 64 YWAL 67 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 63.7 bits (148), Expect = 8e-11 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 5/42 (11%) Frame = +1 Query: 118 INCVALTARF-----PVGKPVVPAALMNRPTRGERRFAYWAL 228 + C+A R+ P+GKPVVPAALMNRPTRGERRFAYWAL Sbjct: 58 VRCIAEGGRYKKNVSPIGKPVVPAALMNRPTRGERRFAYWAL 99 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 63.7 bits (148), Expect = 8e-11 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = +1 Query: 85 SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 S+ C + + I+ V L PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 36 SIDCETAIIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYWAL 82 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 63.7 bits (148), Expect = 8e-11 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 145 FPVGKPVVPAALMNRPTRGERRFAYWAL 228 +P+GKPVVPAALMNRPTRGERRFAYWAL Sbjct: 71 YPIGKPVVPAALMNRPTRGERRFAYWAL 98 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 63.7 bits (148), Expect = 8e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 139 ARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 A F VGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 106 AEFSVGKPVVPAALMNRPTRGERRFAYWAL 135 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 63.3 bits (147), Expect = 1e-10 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +1 Query: 97 LMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 L+S + I+ V L PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 97 LLSLIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYWAL 139 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 63.3 bits (147), Expect = 1e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 +S++ I+ V L PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 71 VSDIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYWAL 112 >SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 63.3 bits (147), Expect = 1e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +1 Query: 100 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 +S++ I+ V L PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 111 ISQIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYWAL 152 >SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 63.3 bits (147), Expect = 1e-10 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +1 Query: 112 THINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 T + C R +GKPVVPAALMNRPTRGERRFAYWAL Sbjct: 90 TCLRCSRFHQRLKLGKPVVPAALMNRPTRGERRFAYWAL 128 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 112 PVGKPVVPAALMNRPTRGERRFAYWAL 138 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYWAL 63 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 134 PVGKPVVPAALMNRPTRGERRFAYWAL 160 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 236 PVGKPVVPAALMNRPTRGERRFAYWAL 262 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 56 PVGKPVVPAALMNRPTRGERRFAYWAL 82 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 61 PVGKPVVPAALMNRPTRGERRFAYWAL 87 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 132 PVGKPVVPAALMNRPTRGERRFAYWAL 158 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 50 PVGKPVVPAALMNRPTRGERRFAYWAL 76 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 146 PVGKPVVPAALMNRPTRGERRFAYWAL 172 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 43 PVGKPVVPAALMNRPTRGERRFAYWAL 69 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 33 PVGKPVVPAALMNRPTRGERRFAYWAL 59 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 333 PVGKPVVPAALMNRPTRGERRFAYWAL 359 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 88 PVGKPVVPAALMNRPTRGERRFAYWAL 114 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 74 PVGKPVVPAALMNRPTRGERRFAYWAL 100 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 307 PVGKPVVPAALMNRPTRGERRFAYWAL 333 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 108 PVGKPVVPAALMNRPTRGERRFAYWAL 134 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 34 PVGKPVVPAALMNRPTRGERRFAYWAL 60 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 468 PVGKPVVPAALMNRPTRGERRFAYWAL 494 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 28 PVGKPVVPAALMNRPTRGERRFAYWAL 54 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 93 PVGKPVVPAALMNRPTRGERRFAYWAL 119 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYWAL 79 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 154 PVGKPVVPAALMNRPTRGERRFAYWAL 180 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYWAL 79 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 161 PVGKPVVPAALMNRPTRGERRFAYWAL 187 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 57 PVGKPVVPAALMNRPTRGERRFAYWAL 83 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 79 PVGKPVVPAALMNRPTRGERRFAYWAL 105 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 62.9 bits (146), Expect = 1e-10 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +1 Query: 91 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 G LM ++ C+ GKPVVPAALMNRPTRGERRFAYWAL Sbjct: 26 GVLMFVISFSGCLGALRENVFGKPVVPAALMNRPTRGERRFAYWAL 71 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 17 PVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 56 PVGKPVVPAALMNRPTRGERRFAYWAL 82 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 39 PVGKPVVPAALMNRPTRGERRFAYWAL 65 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 290 PVGKPVVPAALMNRPTRGERRFAYWAL 316 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYWAL 63 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 78 PVGKPVVPAALMNRPTRGERRFAYWAL 104 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 24 PVGKPVVPAALMNRPTRGERRFAYWAL 50 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 134 PVGKPVVPAALMNRPTRGERRFAYWAL 160 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 92 PVGKPVVPAALMNRPTRGERRFAYWAL 118 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 33 PVGKPVVPAALMNRPTRGERRFAYWAL 59 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 36 PVGKPVVPAALMNRPTRGERRFAYWAL 62 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 232 PVGKPVVPAALMNRPTRGERRFAYWAL 258 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 135 PVGKPVVPAALMNRPTRGERRFAYWAL 161 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 28 PVGKPVVPAALMNRPTRGERRFAYWAL 54 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 744 PVGKPVVPAALMNRPTRGERRFAYWAL 770 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYWAL 63 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 134 PVGKPVVPAALMNRPTRGERRFAYWAL 160 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 95 PVGKPVVPAALMNRPTRGERRFAYWAL 121 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 219 PVGKPVVPAALMNRPTRGERRFAYWAL 245 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 45 PVGKPVVPAALMNRPTRGERRFAYWAL 71 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYWAL 79 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 1673 PVGKPVVPAALMNRPTRGERRFAYWAL 1699 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 95 PVGKPVVPAALMNRPTRGERRFAYWAL 121 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 63 PVGKPVVPAALMNRPTRGERRFAYWAL 89 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 107 PVGKPVVPAALMNRPTRGERRFAYWAL 133 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 93 PVGKPVVPAALMNRPTRGERRFAYWAL 119 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYWAL 58 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 41 PVGKPVVPAALMNRPTRGERRFAYWAL 67 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 935 PVGKPVVPAALMNRPTRGERRFAYWAL 961 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 82 PVGKPVVPAALMNRPTRGERRFAYWAL 108 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 415 PVGKPVVPAALMNRPTRGERRFAYWAL 441 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 97 PVGKPVVPAALMNRPTRGERRFAYWAL 123 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 70 PVGKPVVPAALMNRPTRGERRFAYWAL 96 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 85 PVGKPVVPAALMNRPTRGERRFAYWAL 111 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 142 PVGKPVVPAALMNRPTRGERRFAYWAL 168 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 111 PVGKPVVPAALMNRPTRGERRFAYWAL 137 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 47 PVGKPVVPAALMNRPTRGERRFAYWAL 73 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 40 PVGKPVVPAALMNRPTRGERRFAYWAL 66 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 70 PVGKPVVPAALMNRPTRGERRFAYWAL 96 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 61 PVGKPVVPAALMNRPTRGERRFAYWAL 87 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 38 PVGKPVVPAALMNRPTRGERRFAYWAL 64 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 31 PVGKPVVPAALMNRPTRGERRFAYWAL 57 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 84 PVGKPVVPAALMNRPTRGERRFAYWAL 110 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 62 PVGKPVVPAALMNRPTRGERRFAYWAL 88 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 94 PVGKPVVPAALMNRPTRGERRFAYWAL 120 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 132 PVGKPVVPAALMNRPTRGERRFAYWAL 158 >SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 49 PVGKPVVPAALMNRPTRGERRFAYWAL 75 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 55 PVGKPVVPAALMNRPTRGERRFAYWAL 81 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 33 PVGKPVVPAALMNRPTRGERRFAYWAL 59 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 14 PVGKPVVPAALMNRPTRGERRFAYWAL 40 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 35 PVGKPVVPAALMNRPTRGERRFAYWAL 61 >SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 44 PVGKPVVPAALMNRPTRGERRFAYWAL 70 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYWAL 63 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 75 PVGKPVVPAALMNRPTRGERRFAYWAL 101 >SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) Length = 138 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 83 PVGKPVVPAALMNRPTRGERRFAYWAL 109 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 127 VALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 228 +++ +F VGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 379 LSMKKKFLVGKPVVPAALMNRPTRGERRFAYWAL 412 >SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 27 PVGKPVVPAALMNRPTRGERRFAYWAL 53 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYWAL 63 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 48 PVGKPVVPAALMNRPTRGERRFAYWAL 74 >SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 92 PVGKPVVPAALMNRPTRGERRFAYWAL 118 >SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 19 PVGKPVVPAALMNRPTRGERRFAYWAL 45 >SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYWAL 58 >SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 18 PVGKPVVPAALMNRPTRGERRFAYWAL 44 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 71 PVGKPVVPAALMNRPTRGERRFAYWAL 97 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 99 PVGKPVVPAALMNRPTRGERRFAYWAL 125 >SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) Length = 435 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 231 PVGKPVVPAALMNRPTRGERRFAYWAL 257 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 100 PVGKPVVPAALMNRPTRGERRFAYWAL 126 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 82 PVGKPVVPAALMNRPTRGERRFAYWAL 108 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 383 PVGKPVVPAALMNRPTRGERRFAYWAL 409 >SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYWAL 79 >SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) Length = 177 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 72 PVGKPVVPAALMNRPTRGERRFAYWAL 98 >SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 31 PVGKPVVPAALMNRPTRGERRFAYWAL 57 >SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYWAL 58 >SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 100 PVGKPVVPAALMNRPTRGERRFAYWAL 126 >SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 82 PVGKPVVPAALMNRPTRGERRFAYWAL 108 >SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 86 PVGKPVVPAALMNRPTRGERRFAYWAL 112 >SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 17 PVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 28 PVGKPVVPAALMNRPTRGERRFAYWAL 54 >SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 77 PVGKPVVPAALMNRPTRGERRFAYWAL 103 >SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) Length = 558 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 453 PVGKPVVPAALMNRPTRGERRFAYWAL 479 >SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) Length = 178 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 73 PVGKPVVPAALMNRPTRGERRFAYWAL 99 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 90 PVGKPVVPAALMNRPTRGERRFAYWAL 116 >SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 23 PVGKPVVPAALMNRPTRGERRFAYWAL 49 >SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) Length = 788 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 733 PVGKPVVPAALMNRPTRGERRFAYWAL 759 >SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 18 PVGKPVVPAALMNRPTRGERRFAYWAL 44 >SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYWAL 58 >SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) Length = 178 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 73 PVGKPVVPAALMNRPTRGERRFAYWAL 99 >SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 34 PVGKPVVPAALMNRPTRGERRFAYWAL 60 >SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 44 PVGKPVVPAALMNRPTRGERRFAYWAL 70 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 62.9 bits (146), Expect = 1e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 148 PVGKPVVPAALMNRPTRGERRFAYWAL 228 PVGKPVVPAALMNRPTRGERRFAYWAL Sbjct: 100 PVGKPVVPAALMNRPTRGERRFAYWAL 126 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,922,283 Number of Sequences: 59808 Number of extensions: 309796 Number of successful extensions: 2741 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2737 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -