BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1035 (614 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 3.6 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 21 8.2 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 21 8.2 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -1 Query: 608 HLIEMNWKQQLDTSTMLPPQISQHSSKCCPMSFS 507 H ++N QQ M ++S ++C P+S S Sbjct: 307 HSNDLNMHQQHHQQNMSHEELSAMVNRCHPLSLS 340 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/29 (31%), Positives = 12/29 (41%) Frame = -3 Query: 564 HAATTNFTTFIKMLSDVLLKVVTVKWLGW 478 H NFT I L ++ V W G+ Sbjct: 264 HYKLANFTVKISGLFEITTITAMVMWFGY 292 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/29 (31%), Positives = 12/29 (41%) Frame = -3 Query: 564 HAATTNFTTFIKMLSDVLLKVVTVKWLGW 478 H NFT I L ++ V W G+ Sbjct: 220 HYKLANFTVKISGLFEITTITAMVMWFGY 248 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,245 Number of Sequences: 336 Number of extensions: 2692 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -