BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1023 (721 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) 47 2e-05 SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 42 5e-04 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43292| Best HMM Match : FYRN (HMM E-Value=6.3e-15) 31 0.94 SB_48580| Best HMM Match : FYRN (HMM E-Value=6.3e-15) 31 0.94 SB_5164| Best HMM Match : FYRN (HMM E-Value=6.3e-15) 31 0.94 SB_45985| Best HMM Match : IQ (HMM E-Value=1.7e-37) 31 1.2 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 29 2.9 SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) 29 3.8 SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) 29 3.8 SB_35214| Best HMM Match : FYRN (HMM E-Value=6.3e-15) 29 5.0 SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) 29 5.0 SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) 28 6.6 SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) 28 6.6 SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) 28 6.6 SB_56854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) 28 6.6 SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) 28 6.6 SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) 28 6.6 SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) 28 6.6 SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) 28 6.6 SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_12593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_36835| Best HMM Match : AMP-binding (HMM E-Value=6.2e-13) 28 8.8 SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) 28 8.8 SB_26684| Best HMM Match : DUF1279 (HMM E-Value=0.52) 28 8.8 SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) 28 8.8 SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) 28 8.8 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +3 Query: 645 MPRHLISDAHEWINEIPTVPI 707 MPRHLISDAHEWINEIPTVPI Sbjct: 1 MPRHLISDAHEWINEIPTVPI 21 >SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) Length = 167 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 562 SALNVNVKKFKQARVNGGSNYDSL 633 +ALNV VKKF QARVNGGSNYDSL Sbjct: 28 AALNVKVKKFNQARVNGGSNYDSL 51 >SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +1 Query: 565 ALNVNVKKFKQARVNGGSNYDSL 633 ALNV VKKF QARVNG SNYDSL Sbjct: 2 ALNVKVKKFNQARVNGWSNYDSL 24 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 574 HSEHWAEITLRQHPRGPSQCFV 509 ++EHWAEITLRQH PSQCFV Sbjct: 48 NNEHWAEITLRQHRFRPSQCFV 69 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +1 Query: 559 PSALNVNVKKFKQARVNGGSNYDS 630 PSALNV VKKF QARVNGG +S Sbjct: 31 PSALNVKVKKFNQARVNGGDPLES 54 >SB_43292| Best HMM Match : FYRN (HMM E-Value=6.3e-15) Length = 645 Score = 31.1 bits (67), Expect = 0.94 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 6/99 (6%) Frame = +1 Query: 184 AIQREAKRLIVKNKRFE-RSQVLALLSNG*TKTKSWNG-NPPSVPL--GSMSL--LGM*Q 345 A+ R L++K+K+F +V +S TK G P ++ L GS+ + LG Sbjct: 141 AVTRGKMMLVLKDKQFHVERRVCVDMSRVRTKGAGLKGAEPHAIQLMKGSLRVESLGKLT 200 Query: 346 NSSDISKGTFPSADLPSRKVVSVSFRARSARFCTTAVQR 462 SSD+ G FP SR SV R R+ T ++ Sbjct: 201 ESSDLKAGVFPIGFKVSRLYWSVLEPTRRCRYYCTITEK 239 >SB_48580| Best HMM Match : FYRN (HMM E-Value=6.3e-15) Length = 847 Score = 31.1 bits (67), Expect = 0.94 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 6/99 (6%) Frame = +1 Query: 184 AIQREAKRLIVKNKRFE-RSQVLALLSNG*TKTKSWNG-NPPSVPL--GSMSL--LGM*Q 345 A+ R L++K+K+F +V +S TK G P ++ L GS+ + LG Sbjct: 141 AVTRGKMMLVLKDKQFHVERRVCVDMSRVRTKGAGLKGAEPHAIQLMKGSLRVESLGKLT 200 Query: 346 NSSDISKGTFPSADLPSRKVVSVSFRARSARFCTTAVQR 462 SSD+ G FP SR SV R R+ T ++ Sbjct: 201 ESSDLKAGVFPIGFKVSRLYWSVLEPTRRCRYYCTITEK 239 >SB_5164| Best HMM Match : FYRN (HMM E-Value=6.3e-15) Length = 435 Score = 31.1 bits (67), Expect = 0.94 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 6/99 (6%) Frame = +1 Query: 184 AIQREAKRLIVKNKRFE-RSQVLALLSNG*TKTKSWNG-NPPSVPL--GSMSL--LGM*Q 345 A+ R L++K+K+F +V +S TK G P ++ L GS+ + LG Sbjct: 141 AVTRGKMMLVLKDKQFHVERRVCVDMSRVRTKGAGLKGAEPHAIQLMKGSLRVESLGKLT 200 Query: 346 NSSDISKGTFPSADLPSRKVVSVSFRARSARFCTTAVQR 462 SSD+ G FP SR SV R R+ T ++ Sbjct: 201 ESSDLKAGVFPIGFKVSRLYWSVLEPTRRCRYYCTITEK 239 >SB_45985| Best HMM Match : IQ (HMM E-Value=1.7e-37) Length = 942 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -2 Query: 264 IRQQG-KDLAPFESFVLDNKPLGFPLDRPV 178 IR+QG + PF+ FV K +GFP+ +PV Sbjct: 240 IRKQGFSERLPFDDFVKRYKVIGFPMHKPV 269 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 29.5 bits (63), Expect = 2.9 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +3 Query: 183 GDPEGSQEAYCQEQKIRKEPSPCLVVEWIDENKELEWESTFSTSRQHE 326 GD + E +E RK P+ VVE IDE++ +E E T T E Sbjct: 1855 GDDDDDLEEEAEEVAERKAPAVVDVVEVIDEDECVEEEETQPTVEDEE 1902 >SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 134 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +2 Query: 152 LGTLNNASTTGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 + + + +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 1 VANIQTLTMSGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 44 >SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) Length = 129 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 155 GTLNNASTTGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 G L + +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 67 GLLVVMTMSGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 109 >SB_35214| Best HMM Match : FYRN (HMM E-Value=6.3e-15) Length = 762 Score = 28.7 bits (61), Expect = 5.0 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 6/91 (6%) Frame = +1 Query: 208 LIVKNKRFE-RSQVLALLSNG*TKTKSWNG-NPPSVPL--GSMSL--LGM*QNSSDISKG 369 L++K+K+F +V +S TK G P ++ L GS+ + LG SSD+ G Sbjct: 1 LVLKDKQFHVERRVCVDMSRVRTKGAGLKGAEPHAIQLMKGSLRVESLGKLTESSDLKAG 60 Query: 370 TFPSADLPSRKVVSVSFRARSARFCTTAVQR 462 FP SR SV R R+ T ++ Sbjct: 61 VFPIGFKVSRLYWSVLEPTRRCRYYCTITEK 91 >SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) Length = 125 Score = 28.7 bits (61), Expect = 5.0 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 13/89 (14%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDR--RK----QRAGMG--IH----LQYL*AA 322 +GR +GK +G S+T+ S+ P R+ R RK +R G G +H L+YL +A Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVHLAAVLEYL-SA 60 Query: 323 *VF*ACNRTLPTYQKVLFLPR-IFLAVRS 406 + +K +PR + LAVR+ Sbjct: 61 EILELAGNAARDNKKTRIIPRHLQLAVRN 89 >SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 28.3 bits (60), Expect = 6.6 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -2 Query: 138 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN 49 D+F+++ GE + IP YDT ++ P + Sbjct: 195 DVFVFYPGEGYRNMHVIPGYDTAADEYPSH 224 >SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 372 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 406 >SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) Length = 74 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPIGRIHRHLRK 36 >SB_56854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 188 IAPLLMHYSRFLTCISRIFSFTTRVNGSLTNSIFLRMTHS 69 I PL+ L C+S + T ++GSL++ + ++TH+ Sbjct: 45 ILPLVPRPKELLECVSNMRLLTWLLHGSLSHMVHSKITHA 84 >SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 126 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) Length = 863 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 739 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 773 >SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) Length = 67 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDRRKQR 283 +GR +GK +G S+T+ S+ P R+ R ++ Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHRHLRK 36 >SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDR 271 +GR +GK +G S+T+ S+ P R+ R Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHR 32 >SB_12593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.9 bits (59), Expect = 8.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -2 Query: 138 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN 49 D+F+++ GE + IP YDT ++ P + Sbjct: 259 DVFVFYPGEGYRNVHVIPGYDTAADEYPSH 288 >SB_36835| Best HMM Match : AMP-binding (HMM E-Value=6.2e-13) Length = 874 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +3 Query: 264 WIDENKELEWESTFSTSRQHESFRHVTELFRHIKRYFSFRGSS 392 W D KEL F S H+ F ++T+ + + +Y F+ S+ Sbjct: 402 WGDRLKELIKYKGFQVSTIHDRFGYITDRLKELIKYKGFQVSA 444 >SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) Length = 126 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDR 271 +GR +GK +G S+T+ S+ P R+ R Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHR 32 >SB_26684| Best HMM Match : DUF1279 (HMM E-Value=0.52) Length = 464 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 186 DPEGSQEAYCQEQKIRKEPSPCLVVEWIDENKELE 290 D + E+ CQE + R E L+ E EN+ELE Sbjct: 135 DDPNTSESSCQEARERNEERLSLIDELERENRELE 169 >SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) Length = 126 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 179 TGRSRGKPRGLLSRTKDSKGAKSLPCCRMDR 271 +GR +GK +G S+T+ S+ P R+ R Sbjct: 2 SGRGKGKAKGTKSKTRSSRAGLQFPVGRIHR 32 >SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) Length = 298 Score = 27.9 bits (59), Expect = 8.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -2 Query: 138 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN 49 D+F+++ GE + IP YDT ++ P + Sbjct: 253 DVFVFYPGEGYRNVHVIPGYDTAADEYPSH 282 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,228,411 Number of Sequences: 59808 Number of extensions: 498273 Number of successful extensions: 1464 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 1359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1464 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -