BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1009 (793 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 28 1.8 SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c... 27 4.1 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 9.4 SPBC9B6.03 |||zinc finger protein|Schizosaccharomyces pombe|chr ... 25 9.4 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.9 bits (59), Expect = 1.8 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 735 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMFSTHRDCESTAY 601 Y+C + +S G L SED ++ W K GLI+ F + E+ Y Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173 >SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 26.6 bits (56), Expect = 4.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 702 LRTPALFFDRCTAPVKLPAWRVLEP 776 LRT +DRC P+K W +EP Sbjct: 53 LRTKFNTYDRCIPPMKKSLWGWIEP 77 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.4 bits (53), Expect = 9.4 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 618 SPYAY*TSGSSQLLPFCSTRGF 683 SPYA+ T S+ L PF STR + Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232 >SPBC9B6.03 |||zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 293 Score = 25.4 bits (53), Expect = 9.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 766 TRQAGSLTGAVHLSKNNAGVLRPAQRGQKP 677 TRQA + TG+V S N++ PA +G P Sbjct: 40 TRQATNGTGSVSGSPNSSSNSTPANQGSLP 69 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,249,919 Number of Sequences: 5004 Number of extensions: 65448 Number of successful extensions: 156 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -