BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1007 (530 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23519-9|ABS19470.1| 203|Caenorhabditis elegans Hypothetical pr... 30 0.90 U50135-4|AAA93455.3| 1487|Caenorhabditis elegans Hypothetical pr... 29 2.7 AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium bind... 28 4.8 Z81588-2|CAB04712.1| 379|Caenorhabditis elegans Hypothetical pr... 27 6.3 Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical pr... 27 6.3 Z68337-3|CAA92750.2| 712|Caenorhabditis elegans Hypothetical pr... 27 6.3 AL032631-9|CAA21575.2| 893|Caenorhabditis elegans Hypothetical ... 27 6.3 >U23519-9|ABS19470.1| 203|Caenorhabditis elegans Hypothetical protein F26G1.11 protein. Length = 203 Score = 30.3 bits (65), Expect = 0.90 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -3 Query: 468 LILNRRFLERRLTDDISANVSVSPRMRCTDSAAHKCNYELFNRNNFSIRY 319 +I+ + R ++I +N++V + SA HK NYEL +F +RY Sbjct: 83 IIIEHGCTKGRSEEEIQSNINVYSEFPISLSALHKHNYEL--NQDFELRY 130 >U50135-4|AAA93455.3| 1487|Caenorhabditis elegans Hypothetical protein C52E12.4 protein. Length = 1487 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 460 EPAFFRTPAHRRYLRK 413 EP+F RTPAH YL K Sbjct: 1451 EPSFLRTPAHMTYLAK 1466 >AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium binding protein homologprotein 1, isoform d protein. Length = 679 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 154 LPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTI 50 +P+ V+ ++ PS +S + VTT V+ TTI Sbjct: 559 VPTTTVIQTTETPSTKSKTTKKVKVTTTTVSTTTI 593 >Z81588-2|CAB04712.1| 379|Caenorhabditis elegans Hypothetical protein T07D10.2 protein. Length = 379 Score = 27.5 bits (58), Expect = 6.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 171 GNLRACCLPWMW*PFLRLPLR 109 GNL +C PW+W F R L+ Sbjct: 330 GNLNSCMNPWLWFHFNRKQLK 350 >Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical protein R13H4.8 protein. Length = 212 Score = 27.5 bits (58), Expect = 6.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 336 CCG*KARSCICAPRCRC 386 CCG C C PRC C Sbjct: 79 CCGCGCGCCCCRPRCCC 95 >Z68337-3|CAA92750.2| 712|Caenorhabditis elegans Hypothetical protein M7.3 protein. Length = 712 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = -3 Query: 360 NYELFNRNNFSIRYWSWNYRGCWHQTCPPIVPR*NIKVYSFRLRGLVRVPYRYF 199 N+ FN + WN + W++ CP + +KV F+ GL+R F Sbjct: 273 NFGKFNIKKVVDFFGFWNIQKTWNKKCPKV-----LKVPQFKSYGLLRTESNKF 321 >AL032631-9|CAA21575.2| 893|Caenorhabditis elegans Hypothetical protein Y106G6H.7 protein. Length = 893 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +3 Query: 126 ETATTSKEGSRRANYPLPAREVVTKNNDTGLLRGLVIGMST 248 E T +RR + PLPA + +N+TGLL ++ +++ Sbjct: 3 ENGATPVAAARR-HRPLPAERATSNSNETGLLINVIRSLTS 42 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,215,706 Number of Sequences: 27780 Number of extensions: 250050 Number of successful extensions: 645 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1049512662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -