BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1005 (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 26 1.0 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 5.5 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 24 5.5 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 23 9.7 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 23 9.7 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 23 9.7 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 23 9.7 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 26.2 bits (55), Expect = 1.0 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 6/65 (9%) Frame = +2 Query: 50 RTLDVRSGRMKL-SSYVRD----FRTPEASRFQSVNEGAL*AQMLGPERW*TM-PGQVEV 211 RT V +G ++ SY +D + T E +SV G +LGP W TM G +++ Sbjct: 588 RTKRVPAGLQRIIHSYFQDRELVYETSEGPVVRSVTAGVPQGSILGPTLWNTMYDGVLDI 647 Query: 212 RGNPD 226 PD Sbjct: 648 ALPPD 652 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 5.5 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -3 Query: 307 LLDGSISLSPLYPVPTIDCTSESLRS--SIRVSPDFDLTRHSSPSF 176 LL+GSI SPL I S +LRS ++R++ S P F Sbjct: 971 LLNGSIDSSPLLHRVDIYAPSRTLRSRETLRLAQPRSSAGRSDPMF 1016 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -2 Query: 713 CIGKTLQRHPFQGWLLRQVSRCTLLSGFRLPWP 615 CI ++L+++P L+RQVS+ + G + +P Sbjct: 359 CINESLRKYPPGANLIRQVSQDYRVPGTDVTFP 391 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 586 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 675 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 586 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 675 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 586 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 675 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 586 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 675 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 801,710 Number of Sequences: 2352 Number of extensions: 16593 Number of successful extensions: 45 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -