BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1005 (729 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276485-1|CAB81951.1| 283|Homo sapiens integral membrane trans... 44 4e-04 BC047726-1|AAH47726.1| 273|Homo sapiens OAF homolog (Drosophila... 34 0.60 AY459296-1|AAR23238.1| 273|Homo sapiens NS5ATP13TP2 protein. 34 0.60 >AJ276485-1|CAB81951.1| 283|Homo sapiens integral membrane transporter protein protein. Length = 283 Score = 44.4 bits (100), Expect = 4e-04 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +1 Query: 181 MVNYAWSGRSQGKP*WRTVAILTC 252 MVNYAW+GRSQ K WR+VA+LTC Sbjct: 1 MVNYAWAGRSQRKLWWRSVAVLTC 24 >BC047726-1|AAH47726.1| 273|Homo sapiens OAF homolog (Drosophila) protein. Length = 273 Score = 33.9 bits (74), Expect = 0.60 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = -2 Query: 650 CTLLSGFRLPWPPSC---CH--ERPTPFMVSHERFLGALNYVWFIPQRQFCL 510 C G L W P CH +RPTP+ + ++ +++PQRQ CL Sbjct: 214 CVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCL 265 >AY459296-1|AAR23238.1| 273|Homo sapiens NS5ATP13TP2 protein. Length = 273 Score = 33.9 bits (74), Expect = 0.60 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = -2 Query: 650 CTLLSGFRLPWPPSC---CH--ERPTPFMVSHERFLGALNYVWFIPQRQFCL 510 C G L W P CH +RPTP+ + ++ +++PQRQ CL Sbjct: 214 CVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCL 265 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,336,345 Number of Sequences: 237096 Number of extensions: 2606920 Number of successful extensions: 12029 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12029 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8623170556 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -