BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1001 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.054 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_32453| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) 29 2.7 SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_40568| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_39139| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) 29 4.7 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 8.3 SB_24390| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) 28 8.3 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = -3 Query: 290 IFRHYLPCREWVFARLLPSLDVVAVSQAPSPESNPDSPLPVTTM 159 +F H L + + + DVVAVSQAPSPESNP+SP PV TM Sbjct: 85 VFVHRLHNKHATKPKPIKYWDVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 221 AVSQAPSPESNPDSPLPVTTM 159 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/59 (37%), Positives = 29/59 (49%) Frame = +2 Query: 302 TLTRPRNRNEYTLNILTRNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 478 T + R ++++ R +WRASL Y K+VAVKKLVV F VG P Sbjct: 44 TCQQTTTRVHAAMHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 102 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.1 bits (82), Expect = 0.013 Identities = 20/42 (47%), Positives = 22/42 (52%) Frame = +2 Query: 353 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 478 R +WRASL Y K+VAVKKLVV F VG P Sbjct: 14 RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 55 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.054 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 220 PFLRLPLRNRTLIPRYP 170 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 0.67 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +2 Query: 365 RASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 478 RASL Y K+VAVKKLVV F VG P Sbjct: 5 RASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 42 >SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +2 Query: 353 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 478 R ASL Y K+VAVKKLVV F VG P Sbjct: 24 RERRAASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 65 >SB_32453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/59 (25%), Positives = 26/59 (44%) Frame = -3 Query: 359 CSSLKYLKCTHSDYEAS*ESRIVIFRHYLPCREWVFARLLPSLDVVAVSQAPSPESNPD 183 CS L YL+C +R+++F H L + + P AV+ P+ + P+ Sbjct: 528 CSILSYLRCNKPPVTIRWRTRLIVFTHLLVSYRSIGGQRAPPRSKRAVTGNPAMMNRPN 586 >SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) Length = 111 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 413 YTKIVAVKKLVVAFVRRAVGAP 478 Y K+VAVKKLVV F VG P Sbjct: 88 YIKVVAVKKLVVGFRDGTVGPP 109 >SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 413 YTKIVAVKKLVVAFVRRAVGAP 478 Y K+VAVKKLVV F VG P Sbjct: 89 YIKVVAVKKLVVGFRDGTVGPP 110 >SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 413 YTKIVAVKKLVVAFVRRAVGAP 478 Y K+VAVKKLVV F VG P Sbjct: 17 YIKVVAVKKLVVGFRDGTVGPP 38 >SB_40568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 197 PEREPEKRLPHPRKAAGAQIPTPGT 271 P+ PE P RKAA + P PGT Sbjct: 167 PQTNPEDSSPGNRKAANRETPPPGT 191 >SB_39139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 249 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 520 HRRYSANVSVSPRMRCTDSAAHKCNYELFNRNNFSIR 410 H + +N S++P + TD HK EL N+N IR Sbjct: 11 HSKTISNRSLNPSITYTDMHRHKSELELKNKNAGKIR 47 >SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) Length = 203 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -1 Query: 451 CNYELFNRNNFSIRYWSWNYRGCWH 377 C + RN +RYW W R C H Sbjct: 91 CEVTVIARNILPVRYWIWLSRKCGH 115 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 197 PEREPEKRLPHPRKAAGAQIPTPGTG 274 P P + +PHPR +IP PG G Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPPPGMG 322 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 239 PSLDVVAVSQAPSPESNPDSPLP 171 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_24390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 490 SPRMRCTDSAAHKCNYELFNRNNFSIRYW-SWNY 392 S R+RCT S + KC + + F W S+NY Sbjct: 147 SYRLRCTSSTSWKCRLTSISESYFKGNNWFSYNY 180 >SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) Length = 829 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 273 PVPGVGICAPAAFLGCGSRFSGSLS 199 P PG+G+ P++ CGS SLS Sbjct: 277 PPPGIGVSCPSSAFVCGSEHVHSLS 301 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,075,025 Number of Sequences: 59808 Number of extensions: 477741 Number of successful extensions: 1617 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1609 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -