BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1001 (694 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09070.1 68416.m01066 glycine-rich protein similar to hypothe... 29 2.9 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 29 3.9 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 3.9 At3g08510.1 68416.m00988 phosphoinositide-specific phospholipase... 28 6.8 >At3g09070.1 68416.m01066 glycine-rich protein similar to hypothetical protein GB:AAD32765 [Arabidopsis thaliana] Length = 685 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -2 Query: 576 EEHRDRILILNRRFLERRLTDDIPQTCQYHRGCGAPTARRTNATTSF 436 EE DR LN +ER L++ P+ G G P R+N+ S+ Sbjct: 563 EEEEDRYRRLNGGMVERSLSESWPELRNGGGGGGGPRMVRSNSNVSW 609 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -3 Query: 248 RLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAE 147 RLLPSL VV+ +P+ + P S LP + + V E Sbjct: 84 RLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLE 117 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 239 PSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 132 PS A + APSP +NP P T V++ ES Sbjct: 39 PSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTES 74 >At3g08510.1 68416.m00988 phosphoinositide-specific phospholipase C (PLC2) identical to phosphoinositide specific phospholipase C(AtPLC2) GI:857374 [Arabidopsis thaliana] Length = 581 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = -3 Query: 179 PLPVTTMVVAETTIES**GRHLKDASPVLDHAICKSYPDSSKLTTSDARPSVDW 18 P V + ++E +E ++ K H + + YP +++T+S+ P V W Sbjct: 339 PDKVRRLSLSEEQLEKAAEKYAKQIVRFTQHNLLRIYPKGTRVTSSNYNPLVGW 392 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,077,099 Number of Sequences: 28952 Number of extensions: 317543 Number of successful extensions: 804 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -