BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0998 (711 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 24 5.4 AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein prot... 23 9.5 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.8 bits (49), Expect = 5.4 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = -1 Query: 462 DQRMLIERFNYIHNIMKIPHTTILENAGVLLSRVFRIKQRHLFLQSLGRAQYDPKKVNYV 283 +QR+ +R+N++ + H I V + + FR+ + LQ++ + V Sbjct: 471 EQRLEADRYNFVTECFFMTHKAIDLGYRVCIEKFFRMNRELHRLQTMYYEMMSQNGAD-V 529 Query: 282 P--IKALVEKSV*XFVIILQNVIL 217 P + +V + F + LQNV+L Sbjct: 530 PSDLMQMVSSQMQQF-LCLQNVLL 552 >AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein protein. Length = 163 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 613 KFYENRLNRV*DSDYI 566 +F+E RL +V D DYI Sbjct: 143 EFFETRLAKVEDDDYI 158 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 700,375 Number of Sequences: 2352 Number of extensions: 14256 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -