BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0997 (646 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 5.8 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 7.7 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 7.7 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.7 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -3 Query: 635 KILEYSAKKIKANPPLLYSILNPETNSLSPSAKSKGVR 522 ++L + A P++YSI N E +KG R Sbjct: 308 QVLTWLGYSNSAFNPIIYSIFNTEFREAFKRILTKGAR 345 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 592 LFYIQY*IQKLTLFHLQQNQKEFDLF 515 L+Y Q + LF L + K+FD+F Sbjct: 99 LYYPQLLREMSALFKLFYHAKDFDIF 124 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 592 LFYIQY*IQKLTLFHLQQNQKEFDLF 515 L+Y Q + LF L + K+FD+F Sbjct: 99 LYYPQLLREMSALFKLFYHAKDFDIF 124 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 284 IVIIAGWSSNSNYALLGGLRSVAQTIS 364 ++ + W+S N + L +V QTIS Sbjct: 16 MIHLIAWASLENTGISDRLENVTQTIS 42 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,117 Number of Sequences: 438 Number of extensions: 1563 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -