Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm0997
         (646 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g07785.1 68415.m00946 NADH-ubiquinone oxidoreductase, putativ...    57   9e-09

>At2g07785.1 68415.m00946 NADH-ubiquinone oxidoreductase, putative
           similar to NADH-ubiquinone oxidoreductase chain 1 (EC
           1.6.5.3) (Swiss-Prot:Q01300) [Petunia hybrida]
          Length = 99

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 24/69 (34%), Positives = 40/69 (57%)
 Frame = +3

Query: 24  LGYIQIRKGPNKVGFIGLLQPFSDAIKLFTKERTYPNFSNYFCYYFSPVFRFIXXXXXXX 203
           + ++Q RKGP+ VG  GLLQP +D  KL  KE   P+ +N+F +  +PV  F+       
Sbjct: 1   MAFVQRRKGPDVVGSFGLLQPLADGSKLILKEPISPSSANFFLFRMAPVATFMLSLVARA 60

Query: 204 XIPYIFNLI 230
            +P+ + ++
Sbjct: 61  VVPFDYGMV 69


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,605,242
Number of Sequences: 28952
Number of extensions: 98074
Number of successful extensions: 252
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 238
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 252
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1334473344
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)