BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0993 (594 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 52 1e-05 UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: ... 48 2e-04 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 47 3e-04 UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;... 38 0.13 UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|... 36 0.54 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 36 0.54 UniRef50_Q0QMQ1 Cluster: Polyketide synthase type I; n=1; Strept... 33 3.8 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 52.0 bits (119), Expect = 1e-05 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -3 Query: 466 RLALQLFLVKIFKVYSFRLRGLVRVPYRYFSSLPPVPGVG 347 RLALQ LVK FKV SF+L+GL RV Y YFSSLPP G G Sbjct: 64 RLALQWILVKGFKVDSFQLQGLERVLYCYFSSLPPRVGSG 103 >UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: LRRG00114 - Rattus norvegicus (Rat) Length = 223 Score = 48.0 bits (109), Expect = 2e-04 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -2 Query: 335 LLPSLDVVAVSQAPSPESNPDSP 267 LLPSLDVVAVSQAPSPE NPDSP Sbjct: 167 LLPSLDVVAVSQAPSPELNPDSP 189 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 47.2 bits (107), Expect = 3e-04 Identities = 27/69 (39%), Positives = 40/69 (57%) Frame = -2 Query: 494 SWNYRGCWHQTCPPIVPR*NI*SVLIPITRPRKSPVSLFFVTTSRAGSG*FARLLPSLDV 315 SWNYR CWHQT P++ + PI ++ + + + + SG +RLL +D+ Sbjct: 7 SWNYRSCWHQT-GPLLGFGTV-ENRTPIHSTKRHQWN-WSLPPPKVSSGKVSRLLLPVDI 63 Query: 314 VAVSQAPSP 288 VA+SQAPSP Sbjct: 64 VAISQAPSP 72 >UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein; n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein - Gallus gallus Length = 508 Score = 38.3 bits (85), Expect = 0.13 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = +3 Query: 24 VDNCGNSRANTCNQNSDQ*WDECLY*IKTN 113 +DNCGNSRANTC + D C+Y KTN Sbjct: 469 LDNCGNSRANTCRRAPTS-GDACIYQTKTN 497 >UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|Rep: Novel protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 118 Score = 36.3 bits (80), Expect = 0.54 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = +1 Query: 208 MSALSTFDGSFCDYHGV 258 MSALSTFDG+FC YHG+ Sbjct: 1 MSALSTFDGTFCAYHGL 17 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 36.3 bits (80), Expect = 0.54 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -2 Query: 314 VAVSQAPSPESNPDSPLPV 258 +A+SQAPSPESN +SPLPV Sbjct: 372 LAISQAPSPESNSNSPLPV 390 >UniRef50_Q0QMQ1 Cluster: Polyketide synthase type I; n=1; Streptomyces aculeolatus|Rep: Polyketide synthase type I - Streptomyces aculeolatus Length = 4308 Score = 33.5 bits (73), Expect = 3.8 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = -2 Query: 494 SWNYRGCWHQTCPPIVPR*NI*SVLIPITRPRKSPVSLFFVTTSRAGS 351 SW Y WH PP PR + + +T P SP + AG+ Sbjct: 3664 SWRYTVTWHPHTPPAAPRAVLTGTWLLLTPPEASPPAALVAALEAAGA 3711 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,312,646 Number of Sequences: 1657284 Number of extensions: 12180442 Number of successful extensions: 34209 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 32600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34180 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41488046300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -