BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0993 (594 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 25 1.8 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 5.6 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 7.4 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 7.4 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 7.4 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 9.8 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 9.8 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 25.0 bits (52), Expect = 1.8 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 305 SQAPSPESNPDSPLPVTPW*SQKLPSKVDKADI*KMR 195 SQ P+P+++ P VT K+P +D A + K R Sbjct: 17 SQPPAPDASCFQPTAVTAEDCCKIPKPIDNAIMEKCR 53 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 23.4 bits (48), Expect = 5.6 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -3 Query: 385 RYFSSLPPVPGVGNLRACCLPWMW*PFLRLPLRNRTLIPRYP 260 RY L + + NLR + LR NRT PRYP Sbjct: 263 RYAQGLGRIEPLANLREPVREAYYPKLLRTS-NNRTFCPRYP 303 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 210 HLKDASPVLDHAICKSY 160 HLKDASP L K++ Sbjct: 449 HLKDASPFLQERAVKNF 465 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.6 bits (46), Expect = 9.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 241 CDYHGVTGNGESGFDSGEGA 300 CD GNG DSG+GA Sbjct: 2025 CDNGCGGGNGNENDDSGDGA 2044 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 22.6 bits (46), Expect = 9.8 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -2 Query: 287 ESNPDSPLPVTPW*SQKLPSKVDKADI*KMRRRYLTMR 174 E P+P P S++LP ++ + RR Y+ ++ Sbjct: 1099 EEEVSPPVPPIPPRSRRLPPSPRTTEMRRRRRNYMQLQ 1136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 636,771 Number of Sequences: 2352 Number of extensions: 13700 Number of successful extensions: 68 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -