BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0991 (539 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 0.93 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 2.1 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 24 2.8 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 2.8 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 2.8 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 23 6.5 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 8.7 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 8.7 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 8.7 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 8.7 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 8.7 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 0.93 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 51 NSSRTSRRRLQATL 10 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 2.1 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -3 Query: 360 RIRFPSKPDTPRSSEPILIPKLRIQFADFPYL 265 R+R + TP+ +++PKL+ + A P+L Sbjct: 5 RLRLITSFGTPQDKRTMVLPKLKDETAVMPFL 36 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 24.2 bits (50), Expect = 2.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 312 LALRTGACRVWTGSGCGRCRVWSM 383 +++ G V G+ C C VWSM Sbjct: 5 ISVHVGQAGVQIGNPCWDCTVWSM 28 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 2.8 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 376 QTRHRPHPLPVQTRHAPVLRANPYSEVT 293 Q H PH Q +H P + P++ V+ Sbjct: 72 QLHHSPHQYHQQVQHQPQPPSTPFANVS 99 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 2.8 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 376 QTRHRPHPLPVQTRHAPVLRANPYSEVT 293 Q H PH Q +H P + P++ V+ Sbjct: 73 QLHHSPHQYHQQVQHQPQPPSTPFANVS 100 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 23.0 bits (47), Expect = 6.5 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -2 Query: 181 PSPEFSRSAESIRTPPQMRCSSRSEPY 101 P P + + E PP++ C+ E Y Sbjct: 39 PEPSTTEATEEESPPPKIECTDPREVY 65 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 89 RIPWNSNAQAEKKTLPGPLG 30 +IPW+ NA+A K G G Sbjct: 317 QIPWDRNAEALAKWASGQTG 336 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 22.6 bits (46), Expect = 8.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 350 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 448 K +RPV DV +C ++S LI LKN I Sbjct: 41 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 73 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 22.6 bits (46), Expect = 8.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 350 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 448 K +RPV DV +C ++S LI LKN I Sbjct: 41 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 73 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 22.6 bits (46), Expect = 8.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 290 IRNFGIRIGSEDRGVSGLDGKRMRPVPG 373 I N I R VSGLD R P PG Sbjct: 10 IGNLFIEPNRYRRIVSGLDSTRGSPAPG 37 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 22.6 bits (46), Expect = 8.7 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -3 Query: 288 QFADFPYLHYSTTRGSSPWRPAA--DMGTNR 202 Q AD Y T RG+ PW ++G NR Sbjct: 102 QLADRIYFGEETERGAHPWAALLFYNVGRNR 132 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,251 Number of Sequences: 2352 Number of extensions: 12091 Number of successful extensions: 34 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -