BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0983 (715 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80437-14|ABO52817.1| 1590|Caenorhabditis elegans Histone methyl... 29 4.4 U80437-13|ABO52816.1| 1604|Caenorhabditis elegans Histone methyl... 29 4.4 >U80437-14|ABO52817.1| 1590|Caenorhabditis elegans Histone methyltransferase-likeprotein 1, isoform b protein. Length = 1590 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 523 REKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR*ISP 660 R + R RSR+V +N + ++ N R+R+P R R SP Sbjct: 1128 RRRFNGRRSRSRSRSVSPQNYKRRKLDEHDNNHRQRSPIRDRHTSP 1173 >U80437-13|ABO52816.1| 1604|Caenorhabditis elegans Histone methyltransferase-likeprotein 1, isoform a protein. Length = 1604 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 523 REKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR*ISP 660 R + R RSR+V +N + ++ N R+R+P R R SP Sbjct: 1142 RRRFNGRRSRSRSRSVSPQNYKRRKLDEHDNNHRQRSPIRDRHTSP 1187 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,898,201 Number of Sequences: 27780 Number of extensions: 292812 Number of successful extensions: 818 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1666201324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -