BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0978 (546 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 1.6 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 2.8 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 23 5.0 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 23 5.0 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 23 8.7 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.0 bits (52), Expect = 1.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 366 VCEINEHGDAMCNCIKXCPYETDSRRMVCAN 458 +C N H A+C+C C ++ M C N Sbjct: 769 LCSYNTHCFALCHC---CEFDACDCEMTCPN 796 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 24.2 bits (50), Expect = 2.8 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 545 IADHGTDQSCRGKASLAVYFAIRLP-GFV 462 + D TD+S G+ + V FAI P GF+ Sbjct: 231 VLDVSTDESSEGELAAMVSFAIAFPDGFM 259 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.4 bits (48), Expect = 5.0 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = -2 Query: 467 FVEVCAHHASGVCLVGTXL---DAVTH 396 FV+VC +AS LV + DA+TH Sbjct: 304 FVQVCVTYASTYVLVALSIDRYDAITH 330 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 23.4 bits (48), Expect = 5.0 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +3 Query: 369 CEINEHGDAMCNCIKXCPYETD 434 C +H D +C+ ++ CP D Sbjct: 26 CRTPDHRDGVCHPVQQCPSVRD 47 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 22.6 bits (46), Expect = 8.7 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -1 Query: 180 AAELLRRWTFSSRGADPAVPTPHTLASAVQMTAITRANARRPF 52 AA +T ++ PA PH L +++ +A R PF Sbjct: 163 AASSPNAYTNTTIAVQPAPTQPHELVGTDPLSSPLQAAPREPF 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 524,611 Number of Sequences: 2352 Number of extensions: 8428 Number of successful extensions: 49 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -