BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0978 (546 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 48 6e-08 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 27 0.12 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 6.2 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 48.0 bits (109), Expect = 6e-08 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +3 Query: 333 PCLKVHCSAGRVCEINEHGD-AMCNCIKXCPYETDSRRMVCANFNETWQSDCEVYRQRCF 509 PC +C G+ CE++ + A+C C++ CP R VCA+ + + + CE++R C Sbjct: 81 PCASKYCGIGKECELSPNSTIAVCVCMRKCPRR---HRPVCASNGKIYANHCELHRAACH 137 Query: 510 ASTTL 524 + ++L Sbjct: 138 SGSSL 142 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 27.1 bits (57), Expect = 0.12 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = +3 Query: 363 RVCEINEHGDAMCNCIKXCPYETDSRRMVCANFNETWQSDCEVYRQRCFAST 518 +VC H D+ C C+ DS V NFNE+ E R C ST Sbjct: 344 QVCRSRRHSDSCCLCL-------DSMNAVIRNFNES-----ENRRNSCLGST 383 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -3 Query: 199 QPPRCPRGR 173 QPP+CPR R Sbjct: 564 QPPQCPRFR 572 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,611 Number of Sequences: 438 Number of extensions: 2145 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -