BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0977 (544 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-... 31 0.50 At4g01210.1 68417.m00159 glycosyltransferase family protein 1 co... 30 1.1 At4g27520.1 68417.m03952 plastocyanin-like domain-containing pro... 29 1.5 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 2.0 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 28 4.6 At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / halo... 28 4.6 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 28 4.6 At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ... 28 4.6 At5g05360.2 68418.m00577 expressed protein similar to unknown pr... 27 6.1 At5g05360.1 68418.m00578 expressed protein similar to unknown pr... 27 6.1 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 27 6.1 At3g47910.1 68416.m05224 expressed protein low similarity to non... 27 6.1 At4g39070.1 68417.m05533 zinc finger (B-box type) family protein... 27 8.1 At4g29570.1 68417.m04216 cytidine deaminase, putative / cytidine... 27 8.1 At3g16260.1 68416.m02051 metallo-beta-lactamase family protein 27 8.1 >At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-binding protein GUF1 - Saccharomyces cerevisiae, PIR:S50374 Length = 661 Score = 31.1 bits (67), Expect = 0.50 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -2 Query: 234 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHV 88 LG +H PA +I+R P PP +S +++++F E +CY S V Sbjct: 231 LGLEHVLPA-VIERIPPPPG-ISESPLRMLLFDSFFNEYKGVICYVSVV 277 >At4g01210.1 68417.m00159 glycosyltransferase family protein 1 contains Pfam profile: PF00534 Glycosyl transferases group 1 Length = 981 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = -2 Query: 519 VVTFWHLLLKTLYTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRY 349 VV F + LL LYT+ G + +P E + +A F P++ V+ + Y Sbjct: 282 VVVFHNYLLPILYTEFDAGNFYVIPGSPEEVCKAKNLEFPPQKDDVVISIVGSQFLY 338 >At4g27520.1 68417.m03952 plastocyanin-like domain-containing protein similar to PIR|JC7196 phytocyanin-related protein Pn14 {Ipomoea nil}; contains Pfam profile PF02298: Plastocyanin-like domain Length = 349 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/61 (29%), Positives = 25/61 (40%) Frame = -2 Query: 348 SLTDVPPQSNSPPGSVLEPDHAGVLNGDERFPTSPLCTLGTKHRAPADIIDRAPLPPNRV 169 S T PP S +PPG P + ++ TSP ++ K +P P PP Sbjct: 169 SPTTSPPGSTTPPGGAHSPKSSSAVSP----ATSPPGSMAPKSGSPVSPTTSPPAPPKST 224 Query: 168 S 166 S Sbjct: 225 S 225 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 373 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 486 LS R W RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 27.9 bits (59), Expect = 4.6 Identities = 19/60 (31%), Positives = 23/60 (38%) Frame = -2 Query: 336 VPPQSNSPPGSVLEPDHAGVLNGDERFPTSPLCTLGTKHRAPADIIDRAPLPPNRVSNET 157 +PP P S P GD RFP S T + A + P PP SNE+ Sbjct: 237 LPPPPQLPQSSQPPPPGLSGSQGDGRFPESSDFTFDNRMNANITSVPLLP-PPGIPSNES 295 >At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase familiy protein similar to SP|O14072 Cation-transporting ATPase 4 (EC 3.6.3.-) {Schizosaccharomyces pombe}; contains InterPro accession IPR001757: ATPase, E1-E2 type; contains Pfam profile PF00702: haloacid dehalogenase-like hydrolase Length = 1179 Score = 27.9 bits (59), Expect = 4.6 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -2 Query: 507 WHLLLKTLYTKGSIG-RAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTD 337 +H+L+ L+T S+ + F + +DQA C P + S E+ H R +TD Sbjct: 61 FHILV-LLFTTWSVDFKCFVQFSKVNSIDQADACKVTPAKFSGSKEVVPLHFRSQMTD 117 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 198 DRAPLPPNRVSNETMKVVVFQRRSRET 118 +RAPLP V E + + F +R +ET Sbjct: 7 NRAPLPSPNVKKEALSSIPFDKRRKET 33 >At1g67340.1 68414.m07665 zinc finger (MYND type) family protein / F-box family protein Length = 379 Score = 27.9 bits (59), Expect = 4.6 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -2 Query: 249 SPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 112 S LC LG+ R PAD I+ L R+ M +V R S + I+ Sbjct: 54 SILCKLGSTSRCPADFIN-VLLTCKRLKGLAMNPIVLSRLSPKAIA 98 >At5g05360.2 68418.m00577 expressed protein similar to unknown protein (pir||T02500) Length = 153 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 189 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 79 P P+R S V ++ +R+T SHL Y++ V L+ Sbjct: 20 PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56 >At5g05360.1 68418.m00578 expressed protein similar to unknown protein (pir||T02500) Length = 163 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 189 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 79 P P+R S V ++ +R+T SHL Y++ V L+ Sbjct: 20 PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 116 SPTYATPLMSPYNARLESSSTGSSFPADSPK-PVPLA 9 SPT + + SP A ++ + +S P +SPK P P++ Sbjct: 41 SPTKSPAVTSPTTAPAKTPTASASSPVESPKSPAPVS 77 >At3g47910.1 68416.m05224 expressed protein low similarity to nonmuscle myosin heavy chain (NMHC) [Homo sapiens] GI:189036; contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1290 Score = 27.5 bits (58), Expect = 6.1 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 237 TLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 142 T+G+ HR+ AD ++ +PLP V + + +V Sbjct: 972 TIGSDHRSNADSVEHSPLPVAPVGDHSEADIV 1003 >At4g39070.1 68417.m05533 zinc finger (B-box type) family protein salt-tolerance protein - Arabidopsis thaliana, PID:e224078 Length = 242 Score = 27.1 bits (57), Expect = 8.1 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 426 DQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSP 313 D+A+ C R V +LA HLR+SLT P ++P Sbjct: 20 DEAALCNGCDRHVHFANKLAGKHLRFSLTS-PTFKDAP 56 >At4g29570.1 68417.m04216 cytidine deaminase, putative / cytidine aminohydrolase, putative identical to cytidine deaminase homolog DesA [Arabidopsis thaliana] GI:4836443, cytidine deaminase 8 (CDA8) [Arabidopsis thaliana] GI:5080714; similar to cytidine deaminase (CDD) [Arabidopsis thaliana] GI:3046700; contains Pfam profile PF00383: Cytidine and deoxycytidylate deaminase zinc-binding Length = 293 Score = 27.1 bits (57), Expect = 8.1 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -2 Query: 453 AVPMR--TEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVP 331 A PMR H++ S+ F P+ +S L A+ H R ++ P Sbjct: 2 AQPMRFMLNHIETESYGAFTPQNLSPLINRAIPHTRAQISGSP 44 >At3g16260.1 68416.m02051 metallo-beta-lactamase family protein Length = 937 Score = 27.1 bits (57), Expect = 8.1 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -2 Query: 489 TLYTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHL 355 +L++KGS+ ++ + D +S PF + VL E+ L HL Sbjct: 719 SLFSKGSLMQSIYKRPSSPLTDNSSALPFLKKLKKVLGEMGLEHL 763 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,792,718 Number of Sequences: 28952 Number of extensions: 280039 Number of successful extensions: 839 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1013649368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -