BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0974 (683 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 1.3 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 2.9 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 24 3.9 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 3.9 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 3.9 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 23 6.8 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 23 9.0 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 9.0 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 9.0 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 9.0 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 138 NSSRTSRRRLQATL 97 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -3 Query: 447 RIRFPSKPDTPRSSEPILIPKLRIQFADFPYL 352 R+R + TP+ +++PKL+ + A P+L Sbjct: 5 RLRLITSFGTPQDKRTMVLPKLKDETAVMPFL 36 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 399 LALRTGACRVWTGSGCGRCRVWSM 470 +++ G V G+ C C VWSM Sbjct: 5 ISVHVGQAGVQIGNPCWDCTVWSM 28 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 463 QTRHRPHPLPVQTRHAPVLRANPYSEVT 380 Q H PH Q +H P + P++ V+ Sbjct: 72 QLHHSPHQYHQQVQHQPQPPSTPFANVS 99 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 463 QTRHRPHPLPVQTRHAPVLRANPYSEVT 380 Q H PH Q +H P + P++ V+ Sbjct: 73 QLHHSPHQYHQQVQHQPQPPSTPFANVS 100 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 23.4 bits (48), Expect = 6.8 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -2 Query: 121 SAASSGHFGLPRRTLVFKDEGTIIETVPLPGSGIGTGFPF 2 S+ + F +P T F D T I +P G+G G GFPF Sbjct: 76 SSGAFPQFSIPSWTN-FTDAFTSI--LPFFGNGQGGGFPF 112 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +1 Query: 226 VSGYSLRTLKFR*GMYVEMSRRFVPISAAGLQGEE 330 + GYS+RT +FR +++ + + + + GEE Sbjct: 455 IMGYSMRTDRFRYTAWIKFNPDYFKRDWSTIYGEE 489 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -3 Query: 297 YEPARHLHVHPSPEFQGPQRVSGHRRKCGA 208 ++ H H + GP +S R CGA Sbjct: 655 HQGQHHAQHHSNGTHHGPSLMSSARESCGA 684 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 9.0 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 200 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 81 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 9.0 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 200 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 81 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 780,126 Number of Sequences: 2352 Number of extensions: 16916 Number of successful extensions: 49 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -