BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0972 (382 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 0.54 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 3.8 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 3.8 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 5.0 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 5.0 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 5.0 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 5.0 AJ970248-1|CAI96720.1| 132|Anopheles gambiae putative reverse t... 23 5.0 AJ970247-1|CAI96719.1| 132|Anopheles gambiae putative reverse t... 23 5.0 AJ970246-1|CAI96718.1| 132|Anopheles gambiae putative reverse t... 23 5.0 EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. 22 6.6 EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. 22 6.6 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 22 8.7 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 0.54 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 131 NSSRTSRRRLQATL 90 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 193 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 74 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 193 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 74 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 5.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 169 RIPWNSNAQAEKKTLPGPLG 110 +IPW+ NA+A K G G Sbjct: 317 QIPWDRNAEALAKWASGQTG 336 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 22.6 bits (46), Expect = 5.0 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -3 Query: 290 YEPARHLHVHPSLNFQGPQRVSGHRRKCGA 201 ++ H H + GP +S R CGA Sbjct: 655 HQGQHHAQHHSNGTHHGPSLMSSARESCGA 684 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 5.0 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 93 FGLPRRTLVFKDEGTI 46 FG+P++ + KD GT+ Sbjct: 1660 FGMPKQIVELKDTGTV 1675 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 5.0 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 93 FGLPRRTLVFKDEGTI 46 FG+P++ + KD GT+ Sbjct: 1661 FGMPKQIVELKDTGTV 1676 >AJ970248-1|CAI96720.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 22.6 bits (46), Expect = 5.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 345 ILLYRLDALHLGDLLRIWVRT 283 ILL +LD L L D L W+R+ Sbjct: 83 ILLAKLDRLGLPDPLVAWLRS 103 >AJ970247-1|CAI96719.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 22.6 bits (46), Expect = 5.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 345 ILLYRLDALHLGDLLRIWVRT 283 ILL +LD L L D L W+R+ Sbjct: 83 ILLAKLDRLGLPDPLVAWLRS 103 >AJ970246-1|CAI96718.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 22.6 bits (46), Expect = 5.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 345 ILLYRLDALHLGDLLRIWVRT 283 ILL +LD L L D L W+R+ Sbjct: 83 ILLAKLDRLGLPDPLVAWLRS 103 >EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 6.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 346 YITLSTRCSSPW 311 Y+TL+ C++PW Sbjct: 59 YLTLTHTCNTPW 70 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 21.8 bits (44), Expect = 8.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 269 HVHPSLNFQGPQ 234 HVHPSL PQ Sbjct: 67 HVHPSLRKSAPQ 78 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 436,960 Number of Sequences: 2352 Number of extensions: 9429 Number of successful extensions: 38 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29074284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -