BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0965 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 69 3e-12 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 64 1e-10 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 60 2e-09 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 60 2e-09 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 60 2e-09 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 59 3e-09 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 59 3e-09 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 57 1e-08 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 56 3e-08 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 50 1e-06 SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 49 3e-06 SB_12021| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_57695| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_13724| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37801| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_18006| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 40 0.002 SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 40 0.002 SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48576| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47352| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_46792| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42469| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_47799| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27859| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19196| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 38 0.010 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1184| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_620| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_597| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/59 (64%), Positives = 41/59 (69%) Frame = -3 Query: 371 PVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 P LRANP+ EVTD ADFPYLH SI+ RL TLETCCGY +R S P NFQGP R Sbjct: 37 PTLRANPFPEVTDLFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 93 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 69.3 bits (162), Expect = 3e-12 Identities = 35/59 (59%), Positives = 38/59 (64%) Frame = -3 Query: 371 PVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 P LRANP+ EVTD PYLH SI+ RL TLETCCGY +R S P NFQGP R Sbjct: 141 PTLRANPFPEVTDLFCRLPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 197 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 66.1 bits (154), Expect = 2e-11 Identities = 34/59 (57%), Positives = 37/59 (62%) Frame = -3 Query: 371 PVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 P LRANP+ EVTD P LH SI+ RL TLETCCGY +R S P NFQGP R Sbjct: 37 PTLRANPFPEVTDLFCRLPLLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 93 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 65.7 bits (153), Expect = 3e-11 Identities = 36/79 (45%), Positives = 44/79 (55%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQRVSGHRRKC 171 P NFQG + +GH +KC Sbjct: 84 SP--NFQGRRERTGHHKKC 100 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 65.3 bits (152), Expect = 4e-11 Identities = 35/82 (42%), Positives = 48/82 (58%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY + + + Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDGHE-NQC 82 Query: 227 IPHLNFQGPQRVSGHRRKCGAL 162 +P + F+G + +GH +KCGAL Sbjct: 83 LPRI-FKGRRERTGHHKKCGAL 103 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 63.7 bits (148), Expect = 1e-10 Identities = 37/87 (42%), Positives = 46/87 (52%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQRVSGHRRKCGALRVPNH 147 P NFQGP R ++ G +R +H Sbjct: 84 SP--NFQGPSRAHRTPQETGRMRPYDH 108 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 5e-10 Identities = 35/71 (49%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY NR S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYNRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 61.7 bits (143), Expect = 5e-10 Identities = 35/71 (49%), Positives = 40/71 (56%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L +S++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARRTQSLEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 61.7 bits (143), Expect = 5e-10 Identities = 35/71 (49%), Positives = 40/71 (56%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V TR L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSTRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 60.9 bits (141), Expect = 9e-10 Identities = 35/73 (47%), Positives = 40/73 (54%) Frame = -3 Query: 413 RHRPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDIS 234 R R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 17 RARVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKS 76 Query: 233 TYIPHLNFQGPQR 195 P NFQGP R Sbjct: 77 MSSP--NFQGPSR 87 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 60.9 bits (141), Expect = 9e-10 Identities = 34/63 (53%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = -3 Query: 380 RHAPVLRANPYSE-VTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQG 204 R L ANP+S + ADFPYLH SI+ RL TLETCCGY +R S P NFQG Sbjct: 4 RQTQPLEANPFSRRLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQG 61 Query: 203 PQR 195 P R Sbjct: 62 PSR 64 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 60.9 bits (141), Expect = 9e-10 Identities = 35/90 (38%), Positives = 46/90 (51%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQRVSGHRRKCGALRVPNHISL 138 P + + + GH +KCG H++L Sbjct: 84 FPEFS-RVVESAPGHHKKCGGF--TEHLTL 110 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.5 bits (140), Expect = 1e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 FP--NFQGPSR 92 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 60.1 bits (139), Expect = 2e-09 Identities = 38/82 (46%), Positives = 43/82 (52%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 163 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 222 Query: 227 IPHLNFQGPQRVSGHRRKCGAL 162 P NFQGP R HR AL Sbjct: 223 SP--NFQGPSR--AHRTPQEAL 240 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 60.1 bits (139), Expect = 2e-09 Identities = 38/90 (42%), Positives = 45/90 (50%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQRVSGHRRKCGALRVPNHISL 138 P NFQGP R HR H++L Sbjct: 73 SP--NFQGPSR--AHRTPQEVWCFTEHLTL 98 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 62 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 121 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 122 SP--NFQGPSR 130 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 97 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 156 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 157 SP--NFQGPSR 165 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 84 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 85 SP--NFQGPSR 93 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 84 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 85 SP--NFQGPSR 93 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 97 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 156 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 157 SP--NFQGPSR 165 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 84 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 85 SP--NFQGPSR 93 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 97 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 156 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 157 SP--NFQGPSR 165 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 31 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 90 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 91 SP--NFQGPSR 99 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 84 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 85 SP--NFQGPSR 93 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 84 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 85 SP--NFQGPSR 93 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 166 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 225 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 226 SP--NFQGPSR 234 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 34 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 93 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 94 SP--NFQGPSR 102 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 62 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 121 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 122 SP--NFQGPSR 130 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 62 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 121 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 122 SP--NFQGPSR 130 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 136 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 195 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 196 SP--NFQGPSR 204 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 97 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 156 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 157 SP--NFQGPSR 165 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 96 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 155 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 156 SP--NFQGPSR 164 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 97 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 156 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 157 SP--NFQGPSR 165 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 84 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 85 SP--NFQGPSR 93 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 45 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 104 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 105 SP--NFQGPSR 113 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 135 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 194 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 195 SP--NFQGPSR 203 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 31 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 90 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 91 SP--NFQGPSR 99 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 135 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 194 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 195 SP--NFQGPSR 203 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 122 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 181 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 182 SP--NFQGPSR 190 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 62 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 121 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 122 SP--NFQGPSR 130 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 63 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 122 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 123 SP--NFQGPSR 131 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 62 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 121 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 122 SP--NFQGPSR 130 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.7 bits (138), Expect = 2e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 59.3 bits (137), Expect = 3e-09 Identities = 50/123 (40%), Positives = 59/123 (47%), Gaps = 1/123 (0%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQRVSGHRRKCGALRVPNHISLL*DSMELERS-GRKENSSRTSRRRLQATLG 51 P NFQG R A R P E E S RKENSS+ R+RL+ L Sbjct: 84 SP--NFQGSSR---------AHRTP---------QEGESSLKRKENSSQGPRQRLRVRLR 123 Query: 50 YPV 42 Y + Sbjct: 124 YRI 126 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 59.3 bits (137), Expect = 3e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R +S++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARRTQSKEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 59.3 bits (137), Expect = 3e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLHTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 58.8 bits (136), Expect = 4e-09 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 62 RVHWLQVLARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 121 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 122 SP--NFQGPSR 130 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 58.4 bits (135), Expect = 5e-09 Identities = 33/71 (46%), Positives = 39/71 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH +I+ RL TLETCCGY +R S Sbjct: 37 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCAINQRLLTLETCCGYEYDRTRKSMS 96 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 97 SP--NFQGPSR 105 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 58.0 bits (134), Expect = 6e-09 Identities = 34/71 (47%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILLPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 73 SP--NFQGPSR 81 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 58.0 bits (134), Expect = 6e-09 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ DFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFVDFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 58.0 bits (134), Expect = 6e-09 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPFEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 58.0 bits (134), Expect = 6e-09 Identities = 34/72 (47%), Positives = 39/72 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 63 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 122 Query: 227 IPHLNFQGPQRV 192 P NFQG RV Sbjct: 123 SP--NFQGSSRV 132 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 57.2 bits (132), Expect = 1e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL LETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLKLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 84 SP--NFQGPSR 92 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 56.8 bits (131), Expect = 1e-08 Identities = 37/82 (45%), Positives = 42/82 (51%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 176 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 235 Query: 227 IPHLNFQGPQRVSGHRRKCGAL 162 P NFQG R HR AL Sbjct: 236 SP--NFQGSSR--AHRTPQEAL 253 >SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 56.8 bits (131), Expect = 1e-08 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -2 Query: 327 CRLPLPTLFYRLEALHLGDLLRIWDEPARHLHVHPSPEFSRSAES 193 CRLPLPTLFY+ EA HLGDLLR+ P ++V PEFSR+ ES Sbjct: 92 CRLPLPTLFYQPEAAHLGDLLRLLVRPDTKINVF--PEFSRAVES 134 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 84 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 85 SP--NFQGSSR 93 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 84 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 85 SP--NFQGSSR 93 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 73 SP--NFQGSSR 81 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 73 SP--NFQGSSR 81 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 73 SP--NFQGSSR 81 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 56.4 bits (130), Expect = 2e-08 Identities = 32/84 (38%), Positives = 42/84 (50%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQRVSGHRRKCGALRV 156 P++ F P + R A+ + Sbjct: 84 SPNIEFLQPGGSTRSRASAAAVEL 107 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 56.4 bits (130), Expect = 2e-08 Identities = 34/71 (47%), Positives = 40/71 (56%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L+ + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTN-LKPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 82 Query: 227 IPHLNFQGPQR 195 P NFQGP R Sbjct: 83 SP--NFQGPSR 91 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 73 SP--NFQGSSR 81 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 56.4 bits (130), Expect = 2e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P NFQG R Sbjct: 84 SP--NFQGSSR 92 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 56.0 bits (129), Expect = 3e-08 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -3 Query: 326 ADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 ADFPYLH SI+ RL TLETCCGY +R S P NFQGP R Sbjct: 7 ADFPYLHVSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 48 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 56.0 bits (129), Expect = 3e-08 Identities = 30/59 (50%), Positives = 35/59 (59%) Frame = -3 Query: 371 PVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 P L + ++ ADFPYLH SI+ RL TLETCCGY +R S P NFQGP R Sbjct: 251 PTLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 307 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 56.0 bits (129), Expect = 3e-08 Identities = 33/70 (47%), Positives = 38/70 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQ 198 P NFQG Q Sbjct: 84 SP--NFQGRQ 91 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -3 Query: 326 ADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 ADFPYLH SI+ RL TLETCCGY +R S P NFQGP R Sbjct: 6 ADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 47 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -3 Query: 326 ADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 ADFPYLH SI+ RL TLETCCGY +R S P NFQGP R Sbjct: 6 ADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 47 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -3 Query: 326 ADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 ADFPYLH SI+ RL TLETCCGY +R S P NFQGP R Sbjct: 13 ADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 54 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -3 Query: 326 ADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 ADFPYLH SI+ RL TLETCCGY +R S P NFQGP R Sbjct: 7 ADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 48 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -3 Query: 326 ADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 ADFPYLH SI+ RL TLETCCGY +R S P NFQGP R Sbjct: 6 ADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 47 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 54.8 bits (126), Expect = 6e-08 Identities = 32/68 (47%), Positives = 37/68 (54%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQG 204 P NFQG Sbjct: 84 SP--NFQG 89 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 54.4 bits (125), Expect = 8e-08 Identities = 32/71 (45%), Positives = 38/71 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 227 IPHLNFQGPQR 195 P +FQG R Sbjct: 84 SP--DFQGSSR 92 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 54.4 bits (125), Expect = 8e-08 Identities = 32/71 (45%), Positives = 37/71 (52%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 72 Query: 227 IPHLNFQGPQR 195 P NF G R Sbjct: 73 SP--NFSGASR 81 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.4 bits (120), Expect = 3e-07 Identities = 27/44 (61%), Positives = 29/44 (65%) Frame = -3 Query: 326 ADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQGPQR 195 ADFPYLH SI+ RL TLETCCGY +R S P NFQG R Sbjct: 103 ADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGSSR 144 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 51.2 bits (117), Expect = 7e-07 Identities = 26/41 (63%), Positives = 28/41 (68%) Frame = -3 Query: 326 ADFPYLHYSID*RLFTLETCCGYGTNRRDISTYIPHLNFQG 204 ADFPYLH SI+ RL TLETCCGY +R S P NFQG Sbjct: 6 ADFPYLHVSINQRLLTLETCCGYEYDRTRKSMSSP--NFQG 44 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/54 (48%), Positives = 31/54 (57%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNR 246 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/54 (48%), Positives = 32/54 (59%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNR 246 R H L V +R L + ++ ADFPYLH SI+ RL TLETCCGY +R Sbjct: 24 RVHWLQVSSRQTQSLDPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/63 (44%), Positives = 34/63 (53%) Frame = -3 Query: 407 RPHPLPVQTRHAPVLRANPYSEVTDPIADFPYLHYSID*RLFTLETCCGYGTNRRDISTY 228 R H L V R L + ++ ADFPYLH SI+ RL TLETCCGY +R S Sbjct: 719 RVHWLQVLARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 778 Query: 227 IPH 219 P+ Sbjct: 779 SPN 781 >SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 538 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = -3 Query: 290 RLFTLETCCGYGTNRRDISTYIPHLNFQGPQRVSGHRRKCGAL 162 RL TLETCCGY +R S P NFQG + +GH +KCGAL Sbjct: 107 RLLTLETCCGYEYDRTRKSMSSP--NFQGRRERTGHHKKCGAL 147 >SB_12021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = -3 Query: 290 RLFTLETCCGYGTNRRDISTYIPHLNFQGPQRVSGHRRKCGAL 162 RL TLETCCGY +R S P NFQG + +GH +KCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSMSSP--NFQGRRERTGHHKKCGAL 41 >SB_57695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 47.6 bits (108), Expect = 9e-06 Identities = 23/43 (53%), Positives = 28/43 (65%) Frame = -3 Query: 290 RLFTLETCCGYGTNRRDISTYIPHLNFQGPQRVSGHRRKCGAL 162 RL TLETCCGY +R S P NF+G + +GH +KCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSMSSP--NFKGRRERTGHHKKCGAL 41 >SB_13724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = -3 Query: 290 RLFTLETCCGYGTNRRDISTYIPHLNFQGPQRVSGHRRKCGAL 162 RL TLETCCGY +R S +P + F+G + +GH RKCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSC-LPRI-FKGRRERTGHHRKCGAL 41 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 327 CRLPLPTLFYRLEALHLGDLLR 262 CRLPLPTLFY+ EA HLGDLLR Sbjct: 52 CRLPLPTLFYQPEAAHLGDLLR 73 >SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 290 RLFTLETCCGYGTNRRDISTYIPHLNFQGPQRVSGHRRKCGAL 162 RL TLETCCGY +R S P FQGP R +KCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSMSSP--KFQGPSRAHRTPQKCGAL 41 >SB_37801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/40 (52%), Positives = 25/40 (62%) Frame = -3 Query: 290 RLFTLETCCGYGTNRRDISTYIPHLNFQGPQRVSGHRRKC 171 RL TLETCCGY +R S P NFQG + +GH +KC Sbjct: 1 RLLTLETCCGYEYDRTRKSCLPP--NFQGRRERTGHHKKC 38 >SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/43 (48%), Positives = 26/43 (60%) Frame = -3 Query: 290 RLFTLETCCGYGTNRRDISTYIPHLNFQGPQRVSGHRRKCGAL 162 RL TLETCCGY +R S P + +R +GH +KCGAL Sbjct: 1 RLLTLETCCGYEYDRTRKSMSFPEFSRAVRER-TGHHKKCGAL 42 >SB_18006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = -3 Query: 290 RLFTLETCCGYGTNRRDISTYIPHLNFQGPQRVSGHRRKCGAL 162 RL LETCCGY +R S P+ + +G + +GH +KCGAL Sbjct: 1 RLLPLETCCGYEYDRTRKSMSSPNFS-RGRRERTGHHKKCGAL 42 >SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 41.5 bits (93), Expect = 6e-04 Identities = 22/48 (45%), Positives = 27/48 (56%) Frame = -3 Query: 290 RLFTLETCCGYGTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNH 147 RL TLETCCGY +R S P NFQGP R ++ G +R +H Sbjct: 1 RLLTLETCCGYEYDRTRKSMSSP--NFQGPSRAHRTPQETGRMRPYDH 46 >SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 41.5 bits (93), Expect = 6e-04 Identities = 22/48 (45%), Positives = 27/48 (56%) Frame = -3 Query: 290 RLFTLETCCGYGTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNH 147 RL TLETCCGY +R S P NFQGP R ++ G +R +H Sbjct: 1 RLLTLETCCGYEYDRTRKSMSSP--NFQGPSRAHRTPQETGRMRPYDH 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,019,603 Number of Sequences: 59808 Number of extensions: 492959 Number of successful extensions: 2731 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2476 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -