BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0961 (384 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 69 2e-12 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 2e-12 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 2e-12 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 7e-08 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 4e-07 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 4e-07 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 48 3e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 48 3e-06 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 45 2e-05 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-05 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 5e-04 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.015 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 30 0.56 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.56 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 1.3 SB_41945| Best HMM Match : Disintegrin (HMM E-Value=2.4) 27 4.0 SB_41433| Best HMM Match : Neur_chan_LBD (HMM E-Value=4.6e-07) 27 4.0 SB_25485| Best HMM Match : ICln_channel (HMM E-Value=0.77) 27 4.0 SB_41657| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_24532| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_49823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_15570| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_59453| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) 27 6.9 SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) 26 9.2 SB_51676| Best HMM Match : LysR_substrate (HMM E-Value=4.2e-29) 26 9.2 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 68.5 bits (160), Expect = 2e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 154 TAGRWPWKSESAKECATTHLPKQPALKMDGAEA 252 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQA 33 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 68.5 bits (160), Expect = 2e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 154 TAGRWPWKSESAKECATTHLPKQPALKMDGAEA 252 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQA 33 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 68.5 bits (160), Expect = 2e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 154 TAGRWPWKSESAKECATTHLPKQPALKMDGAEA 252 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQA 112 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 53.2 bits (122), Expect = 7e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 154 TAGRWPWKSESAKECATTHLPKQPALKMDGAEA 252 TAGR + ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQA 33 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 50.8 bits (116), Expect = 4e-07 Identities = 36/79 (45%), Positives = 40/79 (50%) Frame = -3 Query: 253 TLQRHPFSGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLNTTFGSSHS 74 TL+RHPFSGLVASA + TP F G LN FGSS Sbjct: 27 TLERHPFSGLVASAEQP--TP------------------FVGSDERRLWHLNRAFGSSRI 66 Query: 73 ASSAYQNWPTWHRHQISGF 17 ASSAYQ WPT + H +SGF Sbjct: 67 ASSAYQKWPTRNSHSLSGF 85 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 50.8 bits (116), Expect = 4e-07 Identities = 36/79 (45%), Positives = 40/79 (50%) Frame = -3 Query: 253 TLQRHPFSGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLNTTFGSSHS 74 TL+RHPFSGLVASA + TP F G LN FGSS Sbjct: 25 TLERHPFSGLVASAEQP--TP------------------FVGSDERRLWHLNRAFGSSRI 64 Query: 73 ASSAYQNWPTWHRHQISGF 17 ASSAYQ WPT + H +SGF Sbjct: 65 ASSAYQKWPTSNSHSLSGF 83 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 48.8 bits (111), Expect = 2e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +1 Query: 175 KSESAKECATTHLPKQPALKMDGAEA 252 K ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQA 34 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.8 bits (111), Expect = 2e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +1 Query: 175 KSESAKECATTHLPKQPALKMDGAEA 252 K ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQA 27 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.8 bits (111), Expect = 2e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +1 Query: 175 KSESAKECATTHLPKQPALKMDGAEA 252 K ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQA 27 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 47.6 bits (108), Expect = 3e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 98 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 208 ++ +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 47.6 bits (108), Expect = 3e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 181 ESAKECATTHLPKQPALKMDGAEA 252 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQA 33 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 45.6 bits (103), Expect = 1e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +1 Query: 184 SAKECATTHLPKQPALKMDGAEA 252 SAKEC TTHLPKQ ALKMDGA+A Sbjct: 5 SAKECVTTHLPKQLALKMDGAQA 27 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 45.6 bits (103), Expect = 1e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +1 Query: 184 SAKECATTHLPKQPALKMDGAEA 252 SAKEC TTHLPKQ ALKMDGA+A Sbjct: 5 SAKECVTTHLPKQLALKMDGAQA 27 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 45.6 bits (103), Expect = 1e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +1 Query: 184 SAKECATTHLPKQPALKMDGAEA 252 SAKEC TTHLPKQ ALKMDGA+A Sbjct: 5 SAKECVTTHLPKQLALKMDGAQA 27 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 45.6 bits (103), Expect = 1e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +1 Query: 184 SAKECATTHLPKQPALKMDGAEA 252 SAKEC TTHLPKQ ALKMDGA+A Sbjct: 5 SAKECVTTHLPKQLALKMDGAQA 27 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 45.2 bits (102), Expect = 2e-05 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +1 Query: 175 KSESAKECATTHLPKQPALKMDGAEAFAYTLP 270 K ESAKEC TTHLPKQ ALKM + YT+P Sbjct: 2 KVESAKECVTTHLPKQLALKMMALKRRTYTVP 33 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 54 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 96 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.8 bits (101), Expect = 2e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 139 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.4 bits (100), Expect = 3e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 4e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +1 Query: 187 AKECATTHLPKQPALKMDGAEA 252 AKEC TTHLPKQ ALKMDGA+A Sbjct: 39 AKECVTTHLPKQLALKMDGAQA 60 Score = 39.9 bits (89), Expect = 7e-04 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = +2 Query: 98 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 193 ++ +RS D KGVG S QQDGGHGS NP + Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPAK 40 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 43.6 bits (98), Expect = 6e-05 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN +GSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 2e-04 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = +2 Query: 98 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 193 ++ +RS D KGVG S QQDGGHGS NPL+ Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLK 40 Score = 38.3 bits (85), Expect = 0.002 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +1 Query: 190 KECATTHLPKQPALKMDGAEA 252 KEC TT LPKQ ALKMDGA+A Sbjct: 40 KECVTTPLPKQLALKMDGAQA 60 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 41.5 bits (93), Expect = 2e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSA Q WPT + H +SGF Sbjct: 74 LNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 5e-04 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +3 Query: 114 NAHGTP*KALVAHDSRTVAMEVGIR 188 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.001 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQISGF 17 LN FGSS ASSAYQ PT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.002 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPTWHRHQI 26 LN FGSS ASSAYQ WPT + H + Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSL 42 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.015 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWPT 44 LN FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 30.7 bits (66), Expect = 0.43 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 Query: 103 LNTTFGSSHSASSAYQNWP 47 LN FGSS ASSAYQN P Sbjct: 17 LNRAFGSSRIASSAYQNGP 35 Score = 28.7 bits (61), Expect = 1.7 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = -1 Query: 147 RPTPFMVSHERFLGALTLRLVHPTAPVLLTKIGPLGTVIRSPAS 16 +PTPF+ S ER L L + GPLGT I PAS Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 30.3 bits (65), Expect = 0.56 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -3 Query: 91 FGSSHSASSAYQNWPTWHRHQISGF 17 FGSS ASS YQN PT R GF Sbjct: 78 FGSSRIASSGYQNGPTRTRIHCPGF 102 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 30.3 bits (65), Expect = 0.56 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 204 DSPAEATSPENGWR*SVCLYTTVTGTCDAKFLIWYH 311 +SP + S G VC +TG C A+F+ W++ Sbjct: 609 ESPKKVRSAHKGHATQVCSLPKLTGPCMARFIRWHY 644 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 206 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 111 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_41945| Best HMM Match : Disintegrin (HMM E-Value=2.4) Length = 626 Score = 27.5 bits (58), Expect = 4.0 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +3 Query: 264 TTVTGTCDAKFLIWYH*AVTSRTCATESAKGSGRE 368 +T GTC + LI+ TS++C + ++KG+ ++ Sbjct: 385 STSKGTCCSDDLIFVEETATSKSCTSSTSKGTTQQ 419 >SB_41433| Best HMM Match : Neur_chan_LBD (HMM E-Value=4.6e-07) Length = 175 Score = 27.5 bits (58), Expect = 4.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 114 FLGALTLRLVHPTAPVLLTKIGPLGTV 34 FL A T ++ H T P +T I P+G V Sbjct: 144 FLNAKTAKMHHVTTPNQMTLIAPMGVV 170 >SB_25485| Best HMM Match : ICln_channel (HMM E-Value=0.77) Length = 673 Score = 27.5 bits (58), Expect = 4.0 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +1 Query: 160 GRWPWKSESAKECATTHLPKQPALKMDGAEAFAYTLPLPARVMLNF 297 GR+ W ++C + ++ K+ AE F L L R M++F Sbjct: 283 GRFAWSQTECQDCVSLRTKRRLVNKVMEAERFGEELVLLKREMVSF 328 >SB_41657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 27.1 bits (57), Expect = 5.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 156 CHERPTPFMVSHERFLGALTLRL 88 CH+R P +V LGAL LR+ Sbjct: 243 CHKRDVPVLVDGAHALGALPLRI 265 >SB_24532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 27.1 bits (57), Expect = 5.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 153 DSRTVAMEVGIR 188 DSRTVAMEVGIR Sbjct: 24 DSRTVAMEVGIR 35 >SB_49823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 556 Score = 26.6 bits (56), Expect = 6.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 158 QDGGHGSRNPLRSVQRLTCRSNQP*KWMALKRLPIH 265 +D G G+R PL +Q+ +N+ K + PIH Sbjct: 37 KDSGSGNRRPLTRLQQARIEANKAFKGVKFGDKPIH 72 >SB_15570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 484 Score = 26.6 bits (56), Expect = 6.9 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 166 WPWKSESAKECATTHLPKQP--ALKMDGAEAFAYTLPLP 276 + W +EC T H P +P +L ++ ++ F Y PLP Sbjct: 187 YEWLMHFPEECKTGHAPVEPQTSLFLEDSQ-FGYFYPLP 224 >SB_59453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 26.6 bits (56), Expect = 6.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 170 HGSRNPLRSVQRLTCRSNQP*KWMALKRLPIHYRYRHV 283 HG N + ++ R + + + +K LP+HYRYR V Sbjct: 77 HGGYNKMAAITRRLHMISL--RSVTVKDLPVHYRYRDV 112 >SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) Length = 1953 Score = 26.6 bits (56), Expect = 6.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 277 PVTVVYRQTLQRHPFSGLVA 218 P+T +Y QT+QR SG++A Sbjct: 724 PITTLYNQTVQRVAHSGILA 743 >SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1267 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -1 Query: 384 RRLQAVHAQTLLRSPSRTSYSLRLNDT 304 RRLQA+ ++T L + Y L+ N+T Sbjct: 88 RRLQAIESRTSLHDNNNVFYKLQYNET 114 >SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) Length = 310 Score = 26.2 bits (55), Expect = 9.2 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 142 WSLMTAGRWPWKSES 186 W M AG WPWK ++ Sbjct: 216 WYEMIAGGWPWKKQN 230 >SB_51676| Best HMM Match : LysR_substrate (HMM E-Value=4.2e-29) Length = 313 Score = 26.2 bits (55), Expect = 9.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 144 PTPFMVSHERFLGALTLRLVHPTAPVLLTKIGPL 43 P P +V+ LG + RL APV +I PL Sbjct: 245 PIPAIVAQTDLLGTVPARLAEAFAPVHALEIAPL 278 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,230,797 Number of Sequences: 59808 Number of extensions: 262459 Number of successful extensions: 682 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 656970245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -