BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0961 (384 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 pr... 23 2.9 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 2.9 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 23 3.8 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 23 3.8 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 23 3.8 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 23 3.8 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 5.1 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 5.1 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 22 6.7 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 22 6.7 AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 22 8.9 >AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 protein. Length = 106 Score = 23.4 bits (48), Expect = 2.9 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 270 R*CIGKRFSAIHFQGWLLRQVSR 202 R CIG+RF+ + + L+R +SR Sbjct: 80 RSCIGQRFAMLEMKTVLVRLLSR 102 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.4 bits (48), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 380 GSKLFTPRPFCALRRARPT 324 GSKLF P P AL R T Sbjct: 57 GSKLFAPEPRVALPRVSVT 75 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 137 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 226 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 137 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 226 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 137 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 226 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 137 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 226 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 22.6 bits (46), Expect = 5.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 142 WSLMTAGRWPWKSESAKE 195 WS+ AG W W S SA E Sbjct: 410 WSVC-AGNWMWVSSSAFE 426 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 22.6 bits (46), Expect = 5.1 Identities = 10/31 (32%), Positives = 11/31 (35%) Frame = +1 Query: 130 HERRWSLMTAGRWPWKSESAKECATTHLPKQ 222 H W + WP ES C T KQ Sbjct: 1189 HGPDWLVKDPKHWPKNIESGNTCETAKEEKQ 1219 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 22.2 bits (45), Expect = 6.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 289 ASHVPVTVVYRQTLQRHPFSGL 224 ASH+ + + YR+ +HPF G+ Sbjct: 50 ASHLMLDL-YRELKGKHPFGGI 70 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 22.2 bits (45), Expect = 6.7 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -3 Query: 382 EAPSCSRPD 356 +APSC+RPD Sbjct: 204 DAPSCNRPD 212 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 21.8 bits (44), Expect = 8.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 195 LLSGFRLPWPPSCCHERPTPFMV 127 LL G P PP RP P MV Sbjct: 101 LLMGPNGPLPPPMMGMRPPPMMV 123 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 431,079 Number of Sequences: 2352 Number of extensions: 8346 Number of successful extensions: 65 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -