BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0950 (374 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26001| Best HMM Match : HEAT (HMM E-Value=3.6) 27 3.7 SB_7978| Best HMM Match : F5_F8_type_C (HMM E-Value=1.2e-22) 27 6.5 >SB_26001| Best HMM Match : HEAT (HMM E-Value=3.6) Length = 450 Score = 27.5 bits (58), Expect = 3.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 352 HNTKYNQYLKMSTTTCNCNSRDRVVYGGNSADR 254 H TK N YLK+ + R+ VY G + DR Sbjct: 64 HQTKKNLYLKLDEILIDALHREFEVYPGATVDR 96 >SB_7978| Best HMM Match : F5_F8_type_C (HMM E-Value=1.2e-22) Length = 1151 Score = 26.6 bits (56), Expect = 6.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 27 YS*TYNSAFGRLERCNEPRVDVRK 98 Y S G +ERCN P VD+R+ Sbjct: 212 YPQVVGSCVGIVERCNAPTVDLRR 235 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,531,193 Number of Sequences: 59808 Number of extensions: 167835 Number of successful extensions: 467 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 619783250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -