BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0950 (374 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 24 1.6 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 24 1.6 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 22 8.7 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 205 RTSFSYLAGWKNHCS 249 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 24.2 bits (50), Expect = 1.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 205 RTSFSYLAGWKNHCS 249 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 21.8 bits (44), Expect = 8.7 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +1 Query: 88 MSGRPATSPSCPTALRSPEAFTIVPSSKASLNW 186 +SG +SP PT SP+ K+ W Sbjct: 165 VSGSDMSSPGAPTGSSSPQITPRPTPVKSPYEW 197 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 324,252 Number of Sequences: 2352 Number of extensions: 5871 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 28804305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -