BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0941 (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC18B11.11 ||SPAC1F5.01|GTPase activating protein |Schizosacch... 25 7.8 SPCC777.07 |||alpha-1,2-mannosyltransferase |Schizosaccharomyces... 25 7.8 >SPAC18B11.11 ||SPAC1F5.01|GTPase activating protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1294 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -2 Query: 672 FHTNREQICTYKHTDGNFGKVQ*IYIVSKILLSYFY 565 FH ++ +C Y H N G +Q I + + L+++Y Sbjct: 529 FHEVKDSLCFYAHNSSN-GDLQLRSIQAIVSLTFYY 563 >SPCC777.07 |||alpha-1,2-mannosyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 378 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 389 IYVCYLLHVIVNFYLFFSK 445 IY C LL I++FYL SK Sbjct: 8 IYFCILLFCIISFYLQSSK 26 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,703,165 Number of Sequences: 5004 Number of extensions: 54687 Number of successful extensions: 143 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -