BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0941 (691 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1479 - 26832976-26833095,26833737-26833943,26834104-268342... 29 3.5 05_03_0614 - 16206005-16206586,16207585-16207608,16209746-162098... 29 4.6 12_01_0169 - 1263679-1264349,1264437-1264641 28 8.0 04_04_1035 + 30283456-30283536,30284823-30285359,30285508-302865... 28 8.0 >07_03_1479 - 26832976-26833095,26833737-26833943,26834104-26834252, 26834330-26834732,26834840-26835118,26835285-26835716, 26836362-26836838,26837171-26837212,26837285-26837545, 26837637-26838938,26839146-26839575,26839643-26840046, 26840360-26840716,26840842-26841102,26841494-26842141, 26842231-26842452,26842547-26842768,26842860-26843009, 26843739-26844111,26844467-26844689,26845167-26845425, 26845585-26845920,26846013-26846999,26848395-26849624, 26849706-26849768,26849858-26849910,26849998-26850079, 26850520-26850588,26851070-26851129,26851205-26851267, 26851993-26852101,26852742-26852827,26853120-26853847, 26854613-26854676 Length = 3716 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/62 (25%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Frame = +3 Query: 510 HHIFQNVSVLFLYTKCELNKNMTRVFLKLCRFIEPYQSYRQCVC-MYIFVRGLC--ENKI 680 HH + + + + K E N + F+ +C F+E YQ+ + + ++I + C ENK+ Sbjct: 1749 HHRKELIKFGWNHLKREDNSSKQWAFVNVCHFLEAYQAPEKIILQVFIALLRTCQPENKL 1808 Query: 681 II 686 ++ Sbjct: 1809 LV 1810 >05_03_0614 - 16206005-16206586,16207585-16207608,16209746-16209879, 16210703-16210832 Length = 289 Score = 28.7 bits (61), Expect = 4.6 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 7/51 (13%) Frame = +3 Query: 222 DLCTVLKSYKNYDSSVYI-------DSRQNCLC*CRRVDSSTCPVRSGSGG 353 DL TV++SYK YD SV I D R++ S P+RSG GG Sbjct: 64 DLPTVVESYKTYDDSVLIKTADIGQDRRESQHQLDLEEASQQGPLRSGKGG 114 >12_01_0169 - 1263679-1264349,1264437-1264641 Length = 291 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 5 CSYAHAHECRAFPLALSLSIPPPQER*TFNSTLLEVALEVS 127 C + AH LA + +PPP T N T EVA V+ Sbjct: 55 CLFPSAHRLLPDLLAAKMGLPPPPLISTLNGTAAEVARGVN 95 >04_04_1035 + 30283456-30283536,30284823-30285359,30285508-30286512, 30286718-30287042,30287563-30287818,30287901-30288117, 30288743-30289095,30289330-30289833,30291267-30292467, 30292614-30292970,30293258-30293495,30294083-30295125, 30295234-30296649,30296731-30296855,30297036-30297314, 30297352-30297382,30298957-30299022,30299447-30299689, 30299848-30299898,30299980-30300071,30300182-30300249, 30300515-30300600,30300720-30300824,30300994-30301127, 30302403-30302436,30302620-30302892,30303019-30303288, 30303384-30303974,30304065-30304214 Length = 3376 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 301 DVDVWTVQRALSGLVAAVR*KCYFHIKYSNIRMLFTS 411 DV +++ + L+ + KC+ H SNI MLF S Sbjct: 394 DVTATALKKCIMNLLIHLPRKCFSHDSISNISMLFDS 430 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,042,055 Number of Sequences: 37544 Number of extensions: 289062 Number of successful extensions: 605 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -