BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0941 (691 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004401-1|AAY21240.1| 153|Anopheles gambiae lysozyme c-7 protein. 24 3.9 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 23 6.9 >DQ004401-1|AAY21240.1| 153|Anopheles gambiae lysozyme c-7 protein. Length = 153 Score = 24.2 bits (50), Expect = 3.9 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 543 LYTKCELNKNMTRVFLKLCRFIEPYQSYRQCVCMYIFVRGLCENK 677 +YTKCEL K +T + YQ + VC+ I V GL K Sbjct: 32 IYTKCELAKQLTANGIS-----RTYQGH--WVCLAIAVSGLDTTK 69 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.4 bits (48), Expect = 6.9 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 27 SAAHSLSLCLFLFPLHRSVKRLTQPCW 107 SAA+ L CLF + R +KRL W Sbjct: 503 SAANPLIYCLFSTQVCRMIKRLPPFRW 529 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,998 Number of Sequences: 2352 Number of extensions: 12805 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -