BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0941 (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 25 0.68 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 2.1 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 8.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.4 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 25.0 bits (52), Expect = 0.68 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -2 Query: 648 CTYKHTDGNFGKVQ*IYIVSKILLSYFYSTHI 553 CT ++ GNF ++ ++++ + L Y + T+I Sbjct: 222 CTQVYSTGNFTCLEVVFVLKRRLGYYLFHTYI 253 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -2 Query: 648 CTYKHTDGNFGKVQ*IYIVSKILLSYFYSTHI 553 CT +++ GNF +Q ++ + + L + + T+I Sbjct: 191 CTIEYSTGNFTCIQIVFNLRRRLGYHLFHTYI 222 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +3 Query: 150 NFVKFNYTYTCLSVYY 197 N K+NY C +YY Sbjct: 94 NNYKYNYNNNCKKLYY 109 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 174 YTCLSVYYVYLMRVDEDLCTV 236 ++CL + + L+ +D CTV Sbjct: 376 WSCLFFFMLILIGLDSQFCTV 396 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 174 YTCLSVYYVYLMRVDEDLCTV 236 ++CL + + L+ +D CTV Sbjct: 429 WSCLFFFMLILIGLDSQFCTV 449 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,012 Number of Sequences: 438 Number of extensions: 3726 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -