BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0938 (340 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1328 + 36347963-36347984,36348609-36348764,36349083-363492... 27 2.8 11_08_0007 + 27551173-27551828,27552071-27552282,27553371-275535... 26 8.7 >01_06_1328 + 36347963-36347984,36348609-36348764,36349083-36349261, 36349347-36349442,36349525-36349594,36349635-36349705, 36350654-36351286 Length = 408 Score = 27.5 bits (58), Expect = 2.8 Identities = 11/37 (29%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -2 Query: 225 QTIKPPYGSNCDLNLIDMI-RLKIRIYCHITPMNVRY 118 Q + +G +CD+++ + R+K +I+C I+ ++VR+ Sbjct: 77 QYVSNTFGISCDISVNNYPGRIKSKIFCWISSLDVRF 113 >11_08_0007 + 27551173-27551828,27552071-27552282,27553371-27553550, 27555154-27556187 Length = 693 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -2 Query: 246 LQQNHNFQTIKPPYGSNCDLNLIDMIRLKIRIYCHI 139 L NH+F T PY N ++ I + +IR+Y H+ Sbjct: 61 LSCNHSF-TPPRPYTGNVEIKDISLEAGEIRLYTHV 95 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,614,608 Number of Sequences: 37544 Number of extensions: 123730 Number of successful extensions: 187 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 187 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 470052804 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -