BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0938 (340 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 26 0.45 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 22 5.5 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 21 9.6 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.8 bits (54), Expect = 0.45 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 183 DLNHNCSHTVV*LFENYDSAVTYTIMSNANYSDGXENYHLHKCISIGEVCS 335 D +H C + + + YD+A T+T +SN S + + + IG CS Sbjct: 700 DDHHECRNLKLFEGDPYDNATTFTCVSNCPASHPYKRFP-QEAGKIGPYCS 749 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 240 QNHNFQTIKPPYGSNCD 190 Q+H++ TI P NCD Sbjct: 1253 QHHSYATIGPNCPRNCD 1269 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 247 PTRLCPTLIIVTARKTIIYT 306 PT T I+ RKT+ YT Sbjct: 217 PTETDITFYIIIRRKTLFYT 236 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 339,352 Number of Sequences: 2352 Number of extensions: 6064 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 24206952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -