BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0937 (291 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 29 0.047 DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 0.33 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 1.3 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 1.3 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 2.3 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 2.3 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 3.1 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 3.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 3.1 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 22 4.1 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 22 5.4 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 21 7.1 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 21 7.1 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 21 9.4 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 21 9.4 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 21 9.4 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 28.7 bits (61), Expect = 0.047 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 273 GATSPRNPSPEFSRSAESIRXPPQMRCSSRSEPY 172 G T P P P + + E PP++ C+ E Y Sbjct: 32 GETVPATPEPSTTEATEEESPPPKIECTDPREVY 65 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 0.33 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 122 NSSRTSRRRLQATL 81 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.8 bits (49), Expect = 1.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 291 RIWLRTGATSPRNPSP 244 R W R+GAT R P P Sbjct: 116 RRWTRSGATGRRQPHP 131 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.8 bits (49), Expect = 1.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 291 RIWLRTGATSPRNPSP 244 R W R+GAT R P P Sbjct: 116 RRWTRSGATGRRQPHP 131 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 2.3 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -3 Query: 184 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 65 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 275 PARHLHVIPHLNFQGPQRV 219 P LH +PH+ F QR+ Sbjct: 3 PVFPLHRLPHVAFDKEQRI 21 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 2.3 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -3 Query: 184 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 65 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 275 PARHLHVIPHLNFQGPQRV 219 P LH +PH+ F QR+ Sbjct: 3 PVFPLHRLPHVAFDKEQRI 21 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 160 RIPWNSNAQAEKKTLPGPLG 101 +IPW+ NA+A K G G Sbjct: 317 QIPWDRNAEALAKWASGQTG 336 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 3.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 84 FGLPRRTLVFKDEGTI 37 FG+P++ + KD GT+ Sbjct: 1660 FGMPKQIVELKDTGTV 1675 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 3.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 84 FGLPRRTLVFKDEGTI 37 FG+P++ + KD GT+ Sbjct: 1661 FGMPKQIVELKDTGTV 1676 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 270 ATSPRNPSPEFSRSAESIRXPP 205 +T P PSP+ SR + PP Sbjct: 407 STLPTRPSPKSSRKRRTGHRPP 428 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 21.8 bits (44), Expect = 5.4 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -1 Query: 264 SPRNPSPEFSRSAESIRXPPQMRCSSRSEP 175 +PR SP S R PP R S + P Sbjct: 256 NPRRRSPRSGGRWPSCRSPPARRRSRSTRP 285 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 21.4 bits (43), Expect = 7.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +2 Query: 86 WPEDAAERSGKSFL 127 WPE +SG+ F+ Sbjct: 1127 WPEQGVPKSGQGFI 1140 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 21.4 bits (43), Expect = 7.1 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = -1 Query: 252 PSPEFSRSAESIRXPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKL 118 PS E + S++S + + S +EP + +G + KRK+ Sbjct: 2 PSEEGNVSSQSSSGDTKRKVSIITEPVVERLGHDNLAFEQNKRKI 46 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 188 EEHRICGGXRILSADLENSGEGLR 259 EEH +C ++ A SG+ LR Sbjct: 325 EEHPVCDFGELMPAIRSKSGDLLR 348 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 188 EEHRICGGXRILSADLENSGEGLR 259 EEH +C ++ A SG+ LR Sbjct: 326 EEHPVCDFGELMPAIRSKSGDLLR 349 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +2 Query: 32 SIIVPSSLKTSVRRGNP 82 S+ P S++ SVR+G+P Sbjct: 636 SLSPPISIRRSVRQGDP 652 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 329,818 Number of Sequences: 2352 Number of extensions: 6657 Number of successful extensions: 19 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 17819379 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -