BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0933 (494 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 57 9e-09 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 52 3e-07 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) 39 0.002 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 39 0.003 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 39 0.003 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 39 0.003 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 39 0.003 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 39 0.003 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 39 0.003 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 39 0.003 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 39 0.003 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 39 0.003 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 39 0.003 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 39 0.003 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 39 0.003 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 39 0.003 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 39 0.003 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 39 0.003 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.014 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_55936| Best HMM Match : Paramecium_SA (HMM E-Value=0.56) 29 2.8 SB_1586| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_47628| Best HMM Match : HEAT (HMM E-Value=1.3e-24) 27 6.4 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 27 6.4 SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27) 27 8.5 SB_40478| Best HMM Match : RpoE2 (HMM E-Value=1.9) 27 8.5 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.1 bits (139), Expect = 1e-09 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -2 Query: 412 VAMEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 VAMEVESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 VAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 56.8 bits (131), Expect = 9e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEVESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 56.8 bits (131), Expect = 9e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEVESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 56.8 bits (131), Expect = 9e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEVESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 56.8 bits (131), Expect = 9e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEVESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 56.8 bits (131), Expect = 9e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEVESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 56.8 bits (131), Expect = 9e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEVESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 56.8 bits (131), Expect = 9e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEVESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 56.8 bits (131), Expect = 9e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEVESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 56.8 bits (131), Expect = 9e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEVESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 55.6 bits (128), Expect = 2e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 ME+ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MELESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 54.0 bits (124), Expect = 6e-08 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEV SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVGSAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 54.0 bits (124), Expect = 6e-08 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEV SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVGSAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 54.0 bits (124), Expect = 6e-08 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 M++ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 54.0 bits (124), Expect = 6e-08 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 M++ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 54.0 bits (124), Expect = 6e-08 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEV SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVGSAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 54.0 bits (124), Expect = 6e-08 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 MEV SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 MEVGSAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 52.4 bits (120), Expect = 2e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -2 Query: 403 EVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 ++ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 8 QLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 52.0 bits (119), Expect = 3e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -2 Query: 403 EVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 ++ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 52.0 bits (119), Expect = 3e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -2 Query: 403 EVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 ++ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 8 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 52.0 bits (119), Expect = 3e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -2 Query: 403 EVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 ++ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 8 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 52.0 bits (119), Expect = 3e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -2 Query: 403 EVESAKECATTHLPKQPALKMDGAEAFCLYTTV 305 ++ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 87 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 48.8 bits (111), Expect = 2e-06 Identities = 26/55 (47%), Positives = 34/55 (61%) Frame = +2 Query: 107 TTVHAKPFSTSVLQGLAGVFATTTXICTDGGSKRAHAQTLLRSPSRTSYCYGLMI 271 T VH +PFSTSV + L +FATTT ICT G +A A+ + +P+ SY L I Sbjct: 113 TAVHMEPFSTSVFKALIRIFATTTKICTGGRFTQARARGCVTTPT-PSYSSELRI 166 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 47.6 bits (108), Expect = 6e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 391 AKECATTHLPKQPALKMDGAEAFCLYTTV 305 AKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 39 AKECVTTHLPKQLALKMDGAQASHLYRAV 67 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +3 Query: 87 DRLTREXLLFTRNPSPRQSSRASLEYLLLPPXSA 188 DRLT LLFT N SP +SS+ S EYLLLPP SA Sbjct: 89 DRLTHVQLLFTWNLSPLRSSKLSFEYLLLPPRSA 122 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 406 MEVESAKECATTHLPKQPALKM 341 M+VESAKEC TTHLPKQ ALKM Sbjct: 1 MKVESAKECVTTHLPKQLALKM 22 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 3e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -2 Query: 388 KECATTHLPKQPALKMDGAEAFCLYTTV 305 KEC TT LPKQ ALKMDGA+A LY V Sbjct: 40 KECVTTPLPKQLALKMDGAQASHLYRAV 67 >SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) Length = 164 Score = 39.1 bits (87), Expect = 0.002 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 107 TTVHAKPFSTSVLQGLAGVFATTTXICTDGGSKRAHAQTLLRSPS 241 T VH PFSTS Q L +FATTT IC G + + + +P+ Sbjct: 48 TAVHMDPFSTSGFQALILIFATTTKICPGGRFTQGSGKGWVTTPT 92 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 95 SASHQLALITSLPFVHTARRY 115 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 167 SASHQLALITSLPFVHTARRY 187 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 51 SASHQLALITSLPFVHTARRY 71 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 52 SASHQLALITSLPFVHTARRY 72 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 114 SASHQLALITSLPFVHTARRY 134 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 49 SASHQLALITSLPFVHTARRY 69 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 52 SASHQLALITSLPFVHTARRY 72 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 28 SASHQLALITSLPFVHTARRY 48 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 42 SASHQLALITSLPFVHTARRY 62 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 41 SASHQLALITSLPFVHTARRY 61 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 48 SASHQLALITSLPFVHTARRY 68 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 28 SASHQLALITSLPFVHTARRY 48 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 52 SASHQLALITSLPFVHTARRY 72 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 52 SASHQLALITSLPFVHTARRY 72 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 49 SASHQLALITSLPFVHTARRY 69 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 206 SASHQLALITSLPFVHTARRY 226 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 114 SASHQLALITSLPFVHTARRY 134 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 42 SASHQLALITSLPFVHTARRY 62 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 14 SASHQLALITSLPFVHTARRY 34 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 162 SASHQLALITSLPFVHTARRY 182 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 28 SASHQLALITSLPFVHTARRY 48 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 51 SASHQLALITSLPFVHTARRY 71 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 162 SASHQLALITSLPFVHTARRY 182 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 114 SASHQLALITSLPFVHTARRY 134 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 103 SASHQLALITSLPFVHTARRY 123 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 28 SASHQLALITSLPFVHTARRY 48 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 49 SASHQLALITSLPFVHTARRY 69 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 88 SASHQLALITSLPFVHTARRY 108 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 165 SASHQLALITSLPFVHTARRY 185 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 131 SASHQLALITSLPFVHTARRY 151 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 16 SASHQLALITSLPFVHTARRY 36 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 167 SASHQLALITSLPFVHTARRY 187 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 114 SASHQLALITSLPFVHTARRY 134 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 28 SASHQLALITSLPFVHTARRY 48 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 93 SASHQLALITSLPFVHTARRY 113 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SASH+LALITSLPFVHT R+ Sbjct: 15 SASHQLALITSLPFVHTARRY 35 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.5 bits (83), Expect = 0.006 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +3 Query: 3 SASHKLALITSLPFVHTPHRH 65 SA+H+LALITSLPFVHT R+ Sbjct: 71 SANHQLALITSLPFVHTARRY 91 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 36.3 bits (80), Expect = 0.014 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 3 SASHKLALITSLPFVHT 53 SASH+LALITSLPFVHT Sbjct: 114 SASHQLALITSLPFVHT 130 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 34.7 bits (76), Expect = 0.042 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 316 IGKTLQRHPFSGLVASA 366 IG TL+RHPFSGLVASA Sbjct: 24 IGATLERHPFSGLVASA 40 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 34.7 bits (76), Expect = 0.042 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 316 IGKTLQRHPFSGLVASA 366 IG TL+RHPFSGLVASA Sbjct: 22 IGATLERHPFSGLVASA 38 >SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 31.9 bits (69), Expect = 0.30 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 210 ARLEPPSVQIXVVVANTPARPWRTDVEKG 124 A ++ P VQI VVVAN R +T+VEKG Sbjct: 34 AWVKRPPVQILVVVANIQMRALKTEVEKG 62 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/64 (25%), Positives = 29/64 (45%) Frame = -2 Query: 457 SWDTMRGVVAHDSRTVAMEVESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCDAKFL 278 SW+ + + S+ A+ +ES K+ + H A C +TG C A+F+ Sbjct: 589 SWNLHVDYIVNKSQPQALRIESPKKVRSAH--------KGHATQVCSLPKLTGPCMARFI 640 Query: 277 IWYH 266 W++ Sbjct: 641 RWHY 644 >SB_55936| Best HMM Match : Paramecium_SA (HMM E-Value=0.56) Length = 581 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 230 RSPSRTSYCYGLMIP 274 RSP+RT CY LMIP Sbjct: 453 RSPTRTPVCYALMIP 467 >SB_1586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 427 HDSRTVAMEVESAKECATTHLPKQ 356 HD A + A EC TT +PKQ Sbjct: 187 HDQEMAASRITIATECMTTQVPKQ 210 >SB_47628| Best HMM Match : HEAT (HMM E-Value=1.3e-24) Length = 921 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 194 GGSKRAHAQTLLRSPSRTSYCYGLMIPN 277 G S R H + SP+ +YC G ++PN Sbjct: 263 GASSRIHCHSAF-SPNSATYCKGTVLPN 289 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 132 PRQSSRASLEYLLLPPXSAPTEAPSGLTPRP 224 PR +S++S+ + PP S P AP+ P P Sbjct: 165 PRTTSQSSIPGVAPPPSSQPAPAPAPPQPAP 195 >SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27) Length = 770 Score = 27.1 bits (57), Expect = 8.5 Identities = 18/45 (40%), Positives = 21/45 (46%) Frame = +2 Query: 116 HAKPFSTSVLQGLAGVFATTTXICTDGGSKRAHAQTLLRSPSRTS 250 HA F V GL G+ AT I T GS R ++ P RTS Sbjct: 410 HATTFLVVVGHGLPGIQATRPRIKTTAGS-RCVLNCIVTLPPRTS 453 >SB_40478| Best HMM Match : RpoE2 (HMM E-Value=1.9) Length = 219 Score = 27.1 bits (57), Expect = 8.5 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -3 Query: 429 LMTAGRWPWKSNPLRSVQRLTCRSNQP*KWMALKRFAYTLPLPARVMLNF*FGIIKP 259 L TAGR+PWK N ++ +R NQ + + + P R+M GI KP Sbjct: 27 LATAGRFPWK-NSVQRARRTATGINQRNSNLITQTLREKIYNPVRIMEPH-CGIAKP 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,800,885 Number of Sequences: 59808 Number of extensions: 326844 Number of successful extensions: 1135 Number of sequences better than 10.0: 110 Number of HSP's better than 10.0 without gapping: 1039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1133 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -