BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0933 (494 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF120981-1|ABO93159.1| 637|Drosophila melanogaster misfire prot... 28 8.0 EF120979-1|ABO93157.1| 1396|Drosophila melanogaster misfire prot... 28 8.0 EF120978-1|ABO93156.1| 839|Drosophila melanogaster misfire prot... 28 8.0 EF120976-1|ABO93154.1| 1437|Drosophila melanogaster misfire prot... 28 8.0 EF120975-1|ABO93153.1| 1659|Drosophila melanogaster misfire prot... 28 8.0 AE014296-1535|AAF50355.1| 1782|Drosophila melanogaster CG5747-PA... 28 8.0 AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 28 8.0 >EF120981-1|ABO93159.1| 637|Drosophila melanogaster misfire protein. Length = 637 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 420 AGRWPWKSNPLRSVQRLTCRSNQP*KWMALKR 325 AG + NPLR +QRL + P KW+ + R Sbjct: 471 AGVFGCSKNPLRKLQRLKYLTPPPLKWVPIAR 502 >EF120979-1|ABO93157.1| 1396|Drosophila melanogaster misfire protein. Length = 1396 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 420 AGRWPWKSNPLRSVQRLTCRSNQP*KWMALKR 325 AG + NPLR +QRL + P KW+ + R Sbjct: 561 AGVFGCSKNPLRKLQRLKYLTPPPLKWVPIAR 592 >EF120978-1|ABO93156.1| 839|Drosophila melanogaster misfire protein. Length = 839 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 420 AGRWPWKSNPLRSVQRLTCRSNQP*KWMALKR 325 AG + NPLR +QRL + P KW+ + R Sbjct: 22 AGVFGCSKNPLRKLQRLKYLTPPPLKWVPIAR 53 >EF120976-1|ABO93154.1| 1437|Drosophila melanogaster misfire protein. Length = 1437 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 420 AGRWPWKSNPLRSVQRLTCRSNQP*KWMALKR 325 AG + NPLR +QRL + P KW+ + R Sbjct: 561 AGVFGCSKNPLRKLQRLKYLTPPPLKWVPIAR 592 >EF120975-1|ABO93153.1| 1659|Drosophila melanogaster misfire protein. Length = 1659 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 420 AGRWPWKSNPLRSVQRLTCRSNQP*KWMALKR 325 AG + NPLR +QRL + P KW+ + R Sbjct: 783 AGVFGCSKNPLRKLQRLKYLTPPPLKWVPIAR 814 >AE014296-1535|AAF50355.1| 1782|Drosophila melanogaster CG5747-PA protein. Length = 1782 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 420 AGRWPWKSNPLRSVQRLTCRSNQP*KWMALKR 325 AG + NPLR +QRL + P KW+ + R Sbjct: 745 AGVFGCSKNPLRKLQRLKYLTPPPLKWVPIAR 776 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +3 Query: 90 RLTREXLLFTRNPSPRQSSRASLEYLLLPPXSAPTEAPSGLTPR 221 RLT E T P P S R +LE + + T+ SG TPR Sbjct: 8019 RLTSEESTETTRPVPTVSPRDALETTVTSLITETTKTTSGGTPR 8062 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,673,043 Number of Sequences: 53049 Number of extensions: 484429 Number of successful extensions: 1284 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1214 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1283 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1742533632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -